Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027788 [exp] 53 / 4e-09 AT5G01510 511 / 3e-178 ROOT UV-B SENSITIVE 5, Protein of unknown function, DUF647 (.1) Lus10035510 [exp] 51 / 2e-08 AT5G01510 511 / 3e-178 ROOT UV-B SENSITIVE 5, Protein of unknown function, DUF647 (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10008289 pacid=23173703 polypeptide=Lus10008289 locus=Lus10008289.g ID=Lus10008289.BGIv1.0 annot-version=v1.0 ATGACTCATTCCCTGAGGCTCTCGTTTCCTAACTGTGCATTCGAATCGTCGACGACGACGAGCAGCAGCCGGAGTAGGAGAGCTCGTCGCTTCCGATTTT CCTGTGCACAGTCCAATCCTCAAGATTCCGAAGACGAGAGGAGTAAGAAGCTCTTTCGAGGAAGATTTGGTCTTCGACTCAATCTCCCCCTCTCCTTCGA CTCAATCTCGAAAGCTACGGCAGCAACTGGACTTCCCCACGTTGTGGAAGACCAACAAGGTTTTCAGCAATTTCCTTCCAAGTTGCTACTTCCACCACCG TCCATCCCTTCCGCCGGTAACTTCTCTATTCTTCAAGTGGGGTTATTCGGACCCAGCTGA
AA sequence Show only first row Show all	>Lus10008289 pacid=23173703 polypeptide=Lus10008289 locus=Lus10008289.g ID=Lus10008289.BGIv1.0 annot-version=v1.0 MTHSLRLSFPNCAFESSTTTSSSRSRRARRFRFSCAQSNPQDSEDERSKKLFRGRFGLRLNLPLSFDSISKATAATGLPHVVEDQQGFQQFPSKLLLPPP SIPSAGNFSILQVGLFGPS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10008289 [exp]	0	1
					Lus10035062 [exp]	2.2	0.9754
AT2G13600			Pentatricopeptide repeat (PPR)...		Lus10026811 [exp]	4.9	0.9676
AT3G14570		ATGSL4, ATGSL04	glucan synthase-like 4 (.1.2)		Lus10026188 [exp]	4.9	0.9676
AT1G75250	MYB	RSM3, ATRL6	RADIALIS-LIKE SANT/MYB 3, RAD-...		Lus10028306 [exp]	5.5	0.9571
					Lus10002859 [exp]	6.3	0.9633
AT1G75250	MYB	RSM3, ATRL6	RADIALIS-LIKE SANT/MYB 3, RAD-...		Lus10033212 [exp]	7.5	0.9551
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10006303 [exp]	7.6	0.9197
					Lus10017955 [exp]	10.5	0.9623
					Lus10035048 [exp]	11.7	0.9482
AT4G21120		CAT1, AAT1	CATIONIC AMINO ACID TRANSPORTE...		Lus10003697 [exp]	11.8	0.9473

Compare expression of checked genes

Lus10008289 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.