Lus10008295 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G78840 67 / 2e-13 F-box/RNI-like/FBD-like domains-containing protein (.1)
AT5G02700 66 / 5e-13 F-box/RNI-like superfamily protein (.1)
AT3G28410 64 / 2e-12 F-box/RNI-like superfamily protein (.1)
AT3G58860 64 / 2e-12 F-box/RNI-like superfamily protein (.1)
AT5G44950 64 / 2e-12 F-box/RNI-like/FBD-like domains-containing protein (.1)
AT5G02930 63 / 4e-12 F-box/RNI-like superfamily protein (.1)
AT1G52650 62 / 9e-12 F-box/RNI-like superfamily protein (.1)
AT3G58880 59 / 1e-10 F-box/RNI-like superfamily protein (.1)
AT4G13960 59 / 1e-10 F-box/RNI-like superfamily protein (.1)
AT3G18150 59 / 2e-10 RNI-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024702 158 / 5e-48 AT5G02930 70 / 5e-13 F-box/RNI-like superfamily protein (.1)
Lus10032255 149 / 7e-44 AT5G02930 85 / 6e-18 F-box/RNI-like superfamily protein (.1)
Lus10006513 140 / 2e-40 AT5G02930 80 / 3e-16 F-box/RNI-like superfamily protein (.1)
Lus10027244 132 / 3e-37 AT5G02930 69 / 2e-12 F-box/RNI-like superfamily protein (.1)
Lus10038967 134 / 5e-37 AT3G18150 77 / 9e-15 RNI-like superfamily protein (.1)
Lus10020292 127 / 1e-35 AT1G60410 76 / 9e-15 F-box family protein (.1)
Lus10027258 125 / 2e-35 AT4G03220 74 / 9e-15 Protein with RNI-like/FBD-like domains (.1)
Lus10014161 124 / 2e-34 AT5G53840 64 / 4e-11 F-box/RNI-like/FBD-like domains-containing protein (.1)
Lus10023567 109 / 2e-30 AT4G03220 59 / 3e-10 Protein with RNI-like/FBD-like domains (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G002100 87 / 1e-20 AT4G03220 103 / 5e-24 Protein with RNI-like/FBD-like domains (.1)
Potri.015G011200 75 / 3e-16 AT4G03220 90 / 1e-19 Protein with RNI-like/FBD-like domains (.1)
Potri.001G337200 71 / 8e-15 AT5G22660 86 / 6e-19 FBD, F-box, Skp2-like and Leucine Rich Repeat domains containing protein (.1.2)
Potri.001G322900 63 / 5e-12 AT3G18150 166 / 1e-45 RNI-like superfamily protein (.1)
Potri.011G104200 61 / 3e-11 AT3G26922 97 / 2e-22 F-box/RNI-like superfamily protein (.1)
Potri.011G104300 61 / 3e-11 AT3G26922 91 / 2e-20 F-box/RNI-like superfamily protein (.1)
Potri.011G104100 61 / 4e-11 AT3G26922 96 / 2e-22 F-box/RNI-like superfamily protein (.1)
Potri.015G002001 60 / 5e-11 AT2G04230 59 / 9e-10 FBD, F-box and Leucine Rich Repeat domains containing protein (.1)
Potri.011G121500 59 / 2e-10 AT4G14103 142 / 6e-38 F-box/RNI-like superfamily protein (.1.2)
Potri.011G024300 58 / 3e-10 AT3G49030 116 / 3e-28 FBD, F-box and Leucine Rich Repeat domains containing protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0271 F-box PF00646 F-box F-box domain
Representative CDS sequence
>Lus10008295 pacid=23173698 polypeptide=Lus10008295 locus=Lus10008295.g ID=Lus10008295.BGIv1.0 annot-version=v1.0
ATGAAGAGAAGTAAAAGGATCAGCAAGGATTCTGAAGGAATCGACCTGCTAAGTGATCTTCCTGACGGTGTTTTGCATCACATTCTTTCCTTTCTCGACA
CTAAATCTTCGATTCAAAGCTGCATTCTATCGAGGAGGTGGAGATGTCTGTGGAAATATGTTCCCGTTCTCACATTCCGCACAAGCTCGGGCGGGAGTGA
CCTGGATTTCGGGAAATATGGGAATCAAGTTCTATCTCTTCGTTTGGATTGTAATGTCTACAAGATTACGTGTGAATTCAATACACCATATAGGATGGAT
CTGTTTGATAGGAGCATGAAATATGGGGCCTCTCAAGGTGTCCAACACTTATTTTTGGCTGCCAATTTGTATGGCGGTGTAGATCTGAAGGCCAGTCCAG
CTCTTTGCAAGTGCTATCAATCTCTAAAAGTTCTGGAATTAGAACAAACATTTTTAGACGATACAGTCAGTTGGATTGTTTTCTGGTTTACAACAACTTG
A
AA sequence
>Lus10008295 pacid=23173698 polypeptide=Lus10008295 locus=Lus10008295.g ID=Lus10008295.BGIv1.0 annot-version=v1.0
MKRSKRISKDSEGIDLLSDLPDGVLHHILSFLDTKSSIQSCILSRRWRCLWKYVPVLTFRTSSGGSDLDFGKYGNQVLSLRLDCNVYKITCEFNTPYRMD
LFDRSMKYGASQGVQHLFLAANLYGGVDLKASPALCKCYQSLKVLELEQTFLDDTVSWIVFWFTTT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G78840 F-box/RNI-like/FBD-like domain... Lus10008295 0 1
Lus10008296 1.0 0.9186
Lus10011725 2.8 0.8670
AT2G27590 S-adenosyl-L-methionine-depend... Lus10020593 5.2 0.7798
Lus10031895 7.3 0.8128
AT2G21200 SAUR-like auxin-responsive pro... Lus10008992 14.7 0.7904
AT1G12740 CYP87A2 "cytochrome P450, family 87, s... Lus10005762 28.6 0.7690
AT4G34180 Cyclase family protein (.1) Lus10031454 29.1 0.7261
AT5G54090 DNA mismatch repair protein Mu... Lus10015589 31.0 0.7841
Lus10007677 31.4 0.7381
AT3G04720 HEL, PR-4, PR4 HEVEIN-LIKE, pathogenesis-rela... Lus10013728 32.2 0.7511

Lus10008295 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.