Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020292 [exp] 86 / 1e-21 AT1G60410 76 / 9e-15 F-box family protein (.1) Lus10032255 [exp] 70 / 9e-16 AT5G02930 85 / 6e-18 F-box/RNI-like superfamily protein (.1) Lus10038935 [exp] 69 / 3e-15 AT1G60400 64 / 3e-11 F-box/RNI-like superfamily protein (.1) Lus10024689 [exp] 67 / 2e-14 AT5G42700 97 / 6e-23 AP2/B3-like transcriptional factor family protein (.1) Lus10024618 [exp] 60 / 1e-13 ND / Lus10032309 [exp] 62 / 5e-13 AT2G46150 65 / 7e-12 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10006513 [exp] 54 / 3e-10 AT5G02930 80 / 3e-16 F-box/RNI-like superfamily protein (.1) Lus10029433 [exp] 53 / 9e-10 AT3G18150 79 / 8e-16 RNI-like superfamily protein (.1) Lus10006970 [exp] 45 / 5e-07 AT4G03220 74 / 3e-14 Protein with RNI-like/FBD-like domains (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G011200 [exp] 40 / 3e-05 AT4G03220 90 / 1e-19 Protein with RNI-like/FBD-like domains (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10008296 pacid=23173722 polypeptide=Lus10008296 locus=Lus10008296.g ID=Lus10008296.BGIv1.0 annot-version=v1.0 ATGTGTGTGTCTAATGTGCAATCCCTCAATTTGCGAATTGAACCCTTAGAGTGGTTGATCCAGACTTGTGACATGGTGAAACTTCAACCATCTCCCTTTA AGCGAATGAAGTCTTTCAATTTCAAGTCTTTTCAAGGATCTCATAACCTACCACATCAAGTCATGCATTACTTTCTTGAAGGCTCTCGTAATGAAGATGA GCAATTTACGGCTAAGGAGGAATGTTGTTGA
AA sequence Show only first row Show all	>Lus10008296 pacid=23173722 polypeptide=Lus10008296 locus=Lus10008296.g ID=Lus10008296.BGIv1.0 annot-version=v1.0 MCVSNVQSLNLRIEPLEWLIQTCDMVKLQPSPFKRMKSFNFKSFQGSHNLPHQVMHYFLEGSRNEDEQFTAKEECC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10008296 [exp]	0	1
AT1G78840			F-box/RNI-like/FBD-like domain...		Lus10008295 [exp]	1.0	0.9186
AT1G21350			Thioredoxin superfamily protei...		Lus10018916 [exp]	8.0	0.7728
AT1G30520		AAE14	acyl-activating enzyme 14 (.1)		Lus10009704 [exp]	11.1	0.7494
					Lus10010602 [exp]	18.2	0.6505
					Lus10011725 [exp]	23.3	0.7589
					Lus10031895 [exp]	23.9	0.7060
AT1G13570			F-box/RNI-like superfamily pro...		Lus10034418 [exp]	25.6	0.7215
AT1G62680			Pentatricopeptide repeat (PPR)...		Lus10042220 [exp]	26.2	0.7256
AT4G34180			Cyclase family protein (.1)		Lus10031454 [exp]	31.0	0.6960
AT2G40770			zinc ion binding;DNA binding;h...		Lus10030511 [exp]	32.0	0.6729

Compare expression of checked genes

Lus10008296 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.