Lus10008318 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G19510 85 / 2e-19 Disease resistance protein (TIR-NBS-LRR class) (.1), Disease resistance protein (TIR-NBS-LRR class) (.2)
AT4G12010 82 / 3e-18 Disease resistance protein (TIR-NBS-LRR class) family (.1)
AT4G11170 80 / 1e-17 Disease resistance protein (TIR-NBS-LRR class) family (.1)
AT4G16990 76 / 4e-16 RLM3 RESISTANCE TO LEPTOSPHAERIA MACULANS 3, disease resistance protein (TIR-NBS class), putative
AT4G19530 75 / 4e-16 disease resistance protein (TIR-NBS-LRR class) family (.1)
AT2G20142 74 / 5e-16 Toll-Interleukin-Resistance (TIR) domain family protein (.1)
AT5G45060 75 / 6e-16 Disease resistance protein (TIR-NBS-LRR class) family (.1)
AT1G57670 74 / 1e-15 Toll-Interleukin-Resistance (TIR) domain family protein (.1)
AT1G72920 72 / 1e-15 Toll-Interleukin-Resistance (TIR) domain family protein (.1)
AT4G16950 73 / 3e-15 RPP5 RECOGNITION OF PERONOSPORA PARASITICA 5, Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028058 254 / 5e-79 AT4G12010 367 / 3e-108 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Lus10008221 183 / 7e-54 AT4G12010 400 / 8e-120 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Lus10028060 160 / 1e-45 AT4G12010 363 / 1e-106 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Lus10008320 158 / 4e-45 AT4G12010 402 / 1e-120 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Lus10008222 154 / 2e-43 AT4G12010 327 / 4e-96 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Lus10023051 152 / 5e-43 AT4G12010 415 / 2e-125 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Lus10012246 138 / 6e-38 AT4G12010 396 / 9e-122 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Lus10009107 137 / 9e-38 AT4G12010 347 / 4e-101 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Lus10008209 125 / 3e-37 AT4G19510 107 / 8e-28 Disease resistance protein (TIR-NBS-LRR class) (.1), Disease resistance protein (TIR-NBS-LRR class) (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G069866 100 / 1e-26 AT4G12010 179 / 4e-52 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Potri.019G070436 96 / 2e-25 AT2G20142 160 / 7e-49 Toll-Interleukin-Resistance (TIR) domain family protein (.1)
Potri.019G070700 101 / 3e-25 AT5G17680 722 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Potri.019G069500 100 / 8e-25 AT5G17680 711 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Potri.019G070393 100 / 8e-25 AT5G17680 629 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Potri.019G069600 99 / 2e-24 AT5G17680 647 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Potri.019G070651 97 / 1e-23 AT5G17680 630 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Potri.013G098100 89 / 2e-22 AT5G36930 159 / 1e-45 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.013G096849 89 / 3e-22 AT5G36930 167 / 4e-48 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.019G098600 88 / 6e-22 AT2G20142 138 / 4e-40 Toll-Interleukin-Resistance (TIR) domain family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0173 STIR PF01582 TIR TIR domain
Representative CDS sequence
>Lus10008318 pacid=23178499 polypeptide=Lus10008318 locus=Lus10008318.g ID=Lus10008318.BGIv1.0 annot-version=v1.0
ATGGCCTCTTCATCTTCCTCTGCTCCTTCACGGCCGTACAGTGGGAAATGGGAATACGACGTTTTCCTATGTTTCAGAGGGGACACGAGGTACGATTTCA
AGAGTCACCTTGAATCAGCTATGAAGGCTAAGAAAATCAGAGTCTTCGTCGACTCAATGCTAAAGAAAACGCAGGACAACGGAGAGCTGCTCGGAATCCT
CGAAAGGACTGCGGTTTCGGTGGTGATTTTTTCGGGCAAGTTCGCTGGTTCGCCCTGGTGCTTGGACGAGGTTTGCACCATCGTTGAGAGCATTGGGAAA
TATGGACACAGCGCACTTCCGGTATTTCACAAAGTGGATTGGATGACTGTTGCTGGCGACTACCATTGCTCCGATTGTTTGAAGTCGGCGATCTGCTGCT
CTTGCTTTCTCGATCGCCAGCCACTGATCAAAGTAACAAGTAAAATTGAAACTGGATCTCATGTGTCGATTTTGTCATCACTAGTAAATCGTGGTAAGAA
ATTAGGTGTGAAGGCACAGATCTGTCTATAG
AA sequence
>Lus10008318 pacid=23178499 polypeptide=Lus10008318 locus=Lus10008318.g ID=Lus10008318.BGIv1.0 annot-version=v1.0
MASSSSSAPSRPYSGKWEYDVFLCFRGDTRYDFKSHLESAMKAKKIRVFVDSMLKKTQDNGELLGILERTAVSVVIFSGKFAGSPWCLDEVCTIVESIGK
YGHSALPVFHKVDWMTVAGDYHCSDCLKSAICCSCFLDRQPLIKVTSKIETGSHVSILSSLVNRGKKLGVKAQICL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G19510 Disease resistance protein (TI... Lus10008318 0 1
AT3G26510 Octicosapeptide/Phox/Bem1p fam... Lus10006214 11.1 0.8470
AT3G44970 Cytochrome P450 superfamily pr... Lus10013060 13.7 0.8226
AT1G61720 BAN BANYULS, NAD(P)-binding Rossma... Lus10020072 16.1 0.6007
Lus10012079 16.1 0.8254
Lus10019151 17.0 0.8189
AT2G23440 unknown protein Lus10009345 17.7 0.7493
AT2G04160 AIR3 AUXIN-INDUCED IN ROOT CULTURES... Lus10039087 19.7 0.8250
AT1G13680 PLC-like phosphodiesterases su... Lus10000649 22.4 0.8146
AT1G28110 SCPL45 serine carboxypeptidase-like 4... Lus10023446 25.7 0.8200
AT2G23945 Eukaryotic aspartyl protease f... Lus10031113 26.4 0.8080

Lus10008318 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.