Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G39020 93 / 7e-23 Malectin/receptor-like protein kinase family protein (.1) AT5G38250 81 / 9e-19 Protein kinase family protein (.1) AT5G38260 80 / 2e-18 Protein kinase superfamily protein (.1) AT5G38240 80 / 2e-18 Protein kinase family protein (.1) AT1G66930 79 / 6e-18 Protein kinase superfamily protein (.1) AT5G39030 79 / 6e-18 Protein kinase superfamily protein (.1) AT1G66920 76 / 5e-17 Protein kinase superfamily protein (.1.2) AT1G66910 76 / 7e-17 Protein kinase superfamily protein (.1) AT1G66980 75 / 1e-16 GDPDL2, SNC4 Glycerophosphodiester phosphodiesterase \(GDPD\) like 2, suppressor of npr1-1 constitutive 4 (.1) AT1G67000 74 / 3e-16 Protein kinase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008335 [exp] 167 / 3e-49 AT1G70250 316 / 8e-98 receptor serine/threonine kinase, putative (.1) Lus10027116 [exp] 157 / 5e-49 AT5G39030 209 / 2e-63 Protein kinase superfamily protein (.1) Lus10025545 [exp] 156 / 7e-48 AT5G39020 316 / 1e-101 Malectin/receptor-like protein kinase family protein (.1) Lus10025544 [exp] 156 / 2e-46 AT5G39020 217 / 1e-62 Malectin/receptor-like protein kinase family protein (.1) Lus10027085 [exp] 152 / 2e-46 AT1G66980 275 / 1e-84 Glycerophosphodiester phosphodiesterase \(GDPD\) like 2, suppressor of npr1-1 constitutive 4 (.1) Lus10027119 [exp] 154 / 4e-45 AT5G38260 210 / 3e-60 Protein kinase superfamily protein (.1) Lus10022359 [exp] 153 / 9e-45 AT1G66980 322 / 3e-101 Glycerophosphodiester phosphodiesterase \(GDPD\) like 2, suppressor of npr1-1 constitutive 4 (.1) Lus10025549 [exp] 141 / 5e-43 AT1G66980 209 / 1e-62 Glycerophosphodiester phosphodiesterase \(GDPD\) like 2, suppressor of npr1-1 constitutive 4 (.1) Lus10025492 [exp] 133 / 2e-37 AT5G38260 326 / 1e-102 Protein kinase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G034500 [exp] 116 / 2e-32 AT5G38260 336 / 6e-111 Protein kinase superfamily protein (.1) Potri.007G125450 [exp] 110 / 3e-29 AT5G38260 300 / 2e-92 Protein kinase superfamily protein (.1) Potri.007G126100 [exp] 109 / 7e-29 AT1G70250 290 / 3e-87 receptor serine/threonine kinase, putative (.1) Potri.007G125800 [exp] 107 / 6e-28 AT5G38260 308 / 1e-95 Protein kinase superfamily protein (.1) Potri.007G125000 [exp] 106 / 1e-27 AT5G38260 318 / 7e-100 Protein kinase superfamily protein (.1) Potri.007G125200 [exp] 105 / 2e-27 AT5G38260 300 / 2e-94 Protein kinase superfamily protein (.1) Potri.017G008100 [exp] 100 / 3e-27 AT4G18250 195 / 8e-58 receptor serine/threonine kinase, putative (.1) Potri.017G009000 [exp] 102 / 5e-27 AT5G38280 306 / 3e-99 PR5-like receptor kinase (.1) Potri.007G141125 [exp] 103 / 6e-27 AT5G38280 335 / 9e-105 PR5-like receptor kinase (.1) Potri.015G122000 [exp] 101 / 2e-26 AT5G38280 336 / 2e-110 PR5-like receptor kinase (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [flax] [poplar] PKinase PF00069 [flax] [poplar] Pkinase Protein kinase domain
Representative CDS sequence Show only first row Show all	>Lus10008333 pacid=23178482 polypeptide=Lus10008333 locus=Lus10008333.g ID=Lus10008333.BGIv1.0 annot-version=v1.0 ATGGGATTGAATATCTGCACAGCGGGTGTGCCATGCAGATTTTGCTTTTACGACCTCAAGCCCCACAACGTTCTTCTTGACGAAAACTTCAACCCGAAAC TGTCAGACTTTGGGGTGGCTAGGCTGTGTTATGCAGGTGATATAGTTGCAACTCTAACTGGATACATGGCGCAGAGTTGTTCTACAGGAATATGGAAGCC TATCTTAGAAAGCTGTGTCTATAGCTTTGGAATGTTACTGTTGGACATGACAGAGAAAAGGAATAACTTGAATGCTGCAACATGTCGTTCGAGTCAAGTT TACTTCCCGTTTTGGGTTCATGATCAGGTTGTGTCCACACCTGGAACTCCTATTGTAGTTGGAGATGATGTGACATAA
AA sequence Show only first row Show all	>Lus10008333 pacid=23178482 polypeptide=Lus10008333 locus=Lus10008333.g ID=Lus10008333.BGIv1.0 annot-version=v1.0 MGLNICTAGVPCRFCFYDLKPHNVLLDENFNPKLSDFGVARLCYAGDIVATLTGYMAQSCSTGIWKPILESCVYSFGMLLLDMTEKRNNLNAATCRSSQV YFPFWVHDQVVSTPGTPIVVGDDVT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G39020			Malectin/receptor-like protein...		Lus10008333 [exp]	0	1
AT5G56990			unknown protein		Lus10029528 [exp]	4.1	0.9654
					Lus10003825 [exp]	5.8	0.9654
AT4G26680			Tetratricopeptide repeat (TPR)...		Lus10020371 [exp]	6.3	0.7876
					Lus10038051 [exp]	7.1	0.9654
AT3G02210		COBL1	COBRA-like protein 1 precursor...		Lus10033047 [exp]	7.5	0.8662
AT5G01660			unknown protein		Lus10040599 [exp]	8.2	0.9654
AT3G12130	C3HZnF		KH domain-containing protein /...		Lus10012016 [exp]	8.5	0.8079
					Lus10029261 [exp]	9.2	0.9654
					Lus10006287 [exp]	9.5	0.8620
AT4G27420		ABCG9	ATP-binding cassette G9, ABC-2...		Lus10029635 [exp]	10.1	0.9654

Compare expression of checked genes

Lus10008333 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.