Lus10008347 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G71490 91 / 2e-21 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G22830 69 / 1e-13 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
AT1G17630 64 / 4e-12 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT2G22070 64 / 6e-12 pentatricopeptide (PPR) repeat-containing protein (.1)
AT1G11290 63 / 7e-12 CRR22 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G26540 62 / 1e-11 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G09410 62 / 2e-11 pentatricopeptide (PPR) repeat-containing protein (.1)
AT1G56690 62 / 3e-11 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G06150 62 / 3e-11 bHLH bHLH089, EMB1444 EMBRYO DEFECTIVE 1444, basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1), basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.2)
AT2G42920 61 / 7e-11 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009487 131 / 2e-35 AT1G71490 758 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10027008 94 / 1e-22 AT1G71490 335 / 7e-107 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10000043 72 / 7e-16 AT1G71490 253 / 1e-80 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10025488 70 / 6e-15 AT1G71490 106 / 9e-27 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10017446 70 / 4e-14 AT1G11290 1152 / 0.0 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10013149 69 / 1e-13 AT1G56690 946 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10003508 67 / 3e-13 AT1G71490 415 / 5e-139 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10031028 66 / 9e-13 AT4G19191 727 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10004892 65 / 3e-12 AT2G27610 998 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G074700 102 / 2e-25 AT1G71490 878 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.005G006400 69 / 1e-13 AT1G56690 993 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.001G243800 68 / 1e-13 AT5G59600 639 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.004G043400 67 / 2e-13 AT2G33760 775 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.006G211400 67 / 4e-13 AT3G11460 772 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.013G089400 66 / 9e-13 AT1G33350 639 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.010G083700 66 / 1e-12 AT3G22690 1050 / 0.0 unknown protein
Potri.004G111300 65 / 2e-12 AT3G02330 1077 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.013G058900 65 / 2e-12 AT4G13650 1282 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.012G108000 64 / 3e-12 AT2G34400 640 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10008347 pacid=23178448 polypeptide=Lus10008347 locus=Lus10008347.g ID=Lus10008347.BGIv1.0 annot-version=v1.0
ATGCCGGATAGGGATGTTGTGTCTTGGAATTCAAGTATTGGTGGTTATGCTTCAAAGGGAATGTGGAAGGAAGCTATTGAGCTGGTCGAAAGAATGCAAT
TAGAAGTTGGTGTCCTAGACTTGCTCTCTAAAATGAGGAAGTCTGATGTTCAGTTGGATTCAGTAGCAATCATTAGTGGTTTAAGTGCATGTTCCCATAT
TGGAGCCTGGAAATTAGGAGCTGAGCTACATGGTTTTGCAATTCGAAATAATTATGATGGATTGGTTGATCCATTCCAGTCTAGTATTCGAAGGGGGAAT
GTTGTTTTGAAAACTGTTGAGTTTCTACAACATCATTCCTCAAATAGAACACTATGCTTGCATGGTGGATCTCTTCGGGAGGGCAGAGATGTTAGATCGA
GCAAAGGAGACGGTATTAAATATGCCTTACAGTCCGACGCCTGCAATTTGGAACCTCTCTTAAGAGCTTGCCAGACTCATGAAAATGCAGATATATGGGA
ATGGGCAGTTACGCGTTTGCTAGAGATGAAACCGGAAAATTTGGGGTCTTAA
AA sequence
>Lus10008347 pacid=23178448 polypeptide=Lus10008347 locus=Lus10008347.g ID=Lus10008347.BGIv1.0 annot-version=v1.0
MPDRDVVSWNSSIGGYASKGMWKEAIELVERMQLEVGVLDLLSKMRKSDVQLDSVAIISGLSACSHIGAWKLGAELHGFAIRNNYDGLVDPFQSSIRRGN
VVLKTVEFLQHHSSNRTLCLHGGSLREGRDVRSSKGDGIKYALQSDACNLEPLLRACQTHENADIWEWAVTRLLEMKPENLGS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G71490 Tetratricopeptide repeat (TPR)... Lus10008347 0 1
AT1G14040 EXS (ERD1/XPR1/SYG1) family pr... Lus10026623 10.8 0.6695
AT2G23660 AS2 LBD10 LOB domain-containing protein ... Lus10009337 13.8 0.5421
AT3G02230 ATRGP1, RGP1 ARABIDOPSIS THALIANA REVERSIBL... Lus10034376 16.6 0.6308
AT3G02125 unknown protein Lus10013196 33.6 0.6050
AT3G24850 B3 Domain of unknown function (DU... Lus10038802 36.7 0.5816
AT1G78160 APUM7 pumilio 7 (.1) Lus10036469 43.0 0.5770
Lus10005955 45.8 0.5895
AT1G13890 ATSNAP30, SNAP3... soluble N-ethylmaleimide-sensi... Lus10036893 52.8 0.5733
AT1G73370 ATSUS6, SUS6 ARABIDOPSIS THALIANA SUCROSE S... Lus10017984 58.0 0.5497
AT4G25140 OLE1, OLEO1 oleosin 1 (.1) Lus10027161 97.0 0.5128

Lus10008347 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.