Lus10008356 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G56130 583 / 0 THO3, AtTEX1 Transducin/WD40 repeat-like superfamily protein (.1)
AT5G67320 99 / 8e-23 HOS15 high expression of osmotically responsive genes 15, WD-40 repeat family protein (.1)
AT5G08560 82 / 3e-17 transducin family protein / WD-40 repeat family protein (.1.2)
AT2G43770 79 / 1e-16 Transducin/WD40 repeat-like superfamily protein (.1)
AT4G02730 75 / 5e-15 AtWDR5b human WDR5 \(WD40 repeat\) homolog b, Transducin/WD40 repeat-like superfamily protein (.1)
AT3G49660 74 / 1e-14 AtWDR5a human WDR5 \(WD40 repeat\) homolog a, Transducin/WD40 repeat-like superfamily protein (.1)
AT5G25150 73 / 4e-14 TAF5 TBP-associated factor 5 (.1)
AT3G18140 66 / 4e-12 Transducin/WD40 repeat-like superfamily protein (.1.2)
AT5G23430 67 / 5e-12 Transducin/WD40 repeat-like superfamily protein (.1.2)
AT5G08390 67 / 5e-12 Transducin/WD40 repeat-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027113 625 / 0 AT5G56130 555 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Lus10024972 92 / 2e-20 AT5G67320 819 / 0.0 high expression of osmotically responsive genes 15, WD-40 repeat family protein (.1)
Lus10004167 87 / 1e-18 AT2G41500 708 / 0.0 LACHESIS, WD-40 repeat family protein / small nuclear ribonucleoprotein Prp4p-related (.1)
Lus10021059 86 / 3e-18 AT2G41500 706 / 0.0 LACHESIS, WD-40 repeat family protein / small nuclear ribonucleoprotein Prp4p-related (.1)
Lus10006916 79 / 2e-16 AT4G02730 506 / 0.0 human WDR5 \(WD40 repeat\) homolog b, Transducin/WD40 repeat-like superfamily protein (.1)
Lus10039636 78 / 4e-16 AT3G49660 502 / 0.0 human WDR5 \(WD40 repeat\) homolog a, Transducin/WD40 repeat-like superfamily protein (.1)
Lus10014674 78 / 4e-16 AT4G02730 508 / 0.0 human WDR5 \(WD40 repeat\) homolog b, Transducin/WD40 repeat-like superfamily protein (.1)
Lus10012230 76 / 3e-15 AT2G43770 620 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Lus10003487 75 / 3e-15 AT3G49660 489 / 6e-176 human WDR5 \(WD40 repeat\) homolog a, Transducin/WD40 repeat-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G470900 600 / 0 AT5G56130 586 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Potri.005G144400 99 / 6e-23 AT5G67320 671 / 0.0 high expression of osmotically responsive genes 15, WD-40 repeat family protein (.1)
Potri.007G050100 95 / 2e-21 AT5G67320 645 / 0.0 high expression of osmotically responsive genes 15, WD-40 repeat family protein (.1)
Potri.002G051900 84 / 4e-18 AT4G02730 524 / 0.0 human WDR5 \(WD40 repeat\) homolog b, Transducin/WD40 repeat-like superfamily protein (.1)
Potri.019G096900 78 / 4e-16 AT2G43770 645 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Potri.005G206600 79 / 5e-16 AT5G08560 736 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2)
Potri.006G045800 74 / 1e-14 AT2G41500 614 / 0.0 LACHESIS, WD-40 repeat family protein / small nuclear ribonucleoprotein Prp4p-related (.1)
Potri.005G148500 73 / 2e-14 AT3G49660 503 / 0.0 human WDR5 \(WD40 repeat\) homolog a, Transducin/WD40 repeat-like superfamily protein (.1)
Potri.008G002700 73 / 4e-14 AT5G08560 616 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2)
Potri.006G145800 72 / 4e-14 AT4G29830 486 / 2e-174 vernalization independence 3, Transducin/WD40 repeat-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0186 Beta_propeller PF00400 WD40 WD domain, G-beta repeat
Representative CDS sequence
>Lus10008356 pacid=23178471 polypeptide=Lus10008356 locus=Lus10008356.g ID=Lus10008356.BGIv1.0 annot-version=v1.0
ATGGAGGAGGCAACAATTCCCTTCAAGAATTTGCACAGCAGAGAGTATCAAGGTCACAAGAAGAAGGTGCATTCGGTTGCTTGGAATTGTACCGGCACCA
AGCTCGCTTCTGGTTCCGTTGATCAAACTGCTCGAATTTGGCACATTGAACCCCACGGCCATGGGAAAGCTAGAGACATTGAGCTGAAAGGGCACACTGA
TAGTGTGGATCAGCTTTGTTGGGACCCCAAACATGCTGATCTTATTGCAACAGCATCTGGAGACAGGACTGTTCGTCTTTGGGATGCTCGTAGTGGGAAA
TGCTCTCAGCAGGCAGAACTTAGCGGAGAAAATATAAACATCACCTACAAACCAGATGGTACCCATGTAGCTGTTGGTAATAGGGACGATGAACTGACAA
TTTTGGATGTTCGGAAATTTAGAACAATTCATAACCGCAAGTTTAATTATGAGGTGAATGAGATTGCTTGGGATATGACTGGAGAGATGTTCCTTTTGAC
GACTGGAAATGGCACTGTTGAAGTACTTAAATACAACCCGGACCTCAAACCAATGGACACCCTCATGGCTCATACAGCAGGTTGCTATTGCATTGCCATT
GATCCAAAAGGAAGATATTTTGCTGTGGGGAGTGCTGATTCATTAGTCAGTCTTTGGGATATTTCAGAGATGCTCTGTGTCCGGACATTTACCAAACTAG
AATGGCCTGTGAGGACGATAAGCTTCAATCACACAGGAGAGTACATAGCTTCTGCAAGTGAAGACTTGTTCATTGACATATCCAATGTTCAAACTGGTCG
ATCAGTTCATCAGATCCCGTGTCGAGCTGCCATGAACAGTGTTGAGTGGAACCCCAAGTACAATTTGCTTGCATATGCTGGCGATGACAAAAAGCATCAG
GCTGATGAAGGTGTTTTCCGTATATTTGGTTTTGACACAGCCTAA
AA sequence
>Lus10008356 pacid=23178471 polypeptide=Lus10008356 locus=Lus10008356.g ID=Lus10008356.BGIv1.0 annot-version=v1.0
MEEATIPFKNLHSREYQGHKKKVHSVAWNCTGTKLASGSVDQTARIWHIEPHGHGKARDIELKGHTDSVDQLCWDPKHADLIATASGDRTVRLWDARSGK
CSQQAELSGENINITYKPDGTHVAVGNRDDELTILDVRKFRTIHNRKFNYEVNEIAWDMTGEMFLLTTGNGTVEVLKYNPDLKPMDTLMAHTAGCYCIAI
DPKGRYFAVGSADSLVSLWDISEMLCVRTFTKLEWPVRTISFNHTGEYIASASEDLFIDISNVQTGRSVHQIPCRAAMNSVEWNPKYNLLAYAGDDKKHQ
ADEGVFRIFGFDTA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G56130 THO3, AtTEX1 Transducin/WD40 repeat-like su... Lus10008356 0 1
AT5G61060 HDA5, HDA05, AT... histone deacetylase 5 (.1.2) Lus10034689 2.4 0.8738
AT3G18165 MOS4 modifier of snc1,4 (.1) Lus10041997 5.3 0.8285
AT2G24530 unknown protein Lus10042444 5.5 0.8190
AT4G21100 DDB1B damaged DNA binding protein 1B... Lus10020922 6.2 0.8425
AT5G08120 MPB2C, ATMBP2C,... movement protein binding prote... Lus10017881 6.3 0.8206
AT3G05290 AtPNC1, PNC1 peroxisomal adenine nucleotide... Lus10010517 7.1 0.8305
AT2G27285 Coiled-coil domain-containing ... Lus10020557 12.5 0.7690
AT1G69060 Chaperone DnaJ-domain superfam... Lus10036825 14.5 0.8155
AT5G19420 Regulator of chromosome conden... Lus10009701 14.7 0.8091
AT5G54930 AT hook motif-containing prote... Lus10016478 14.8 0.8026

Lus10008356 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.