Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G70250 40 / 2e-05 receptor serine/threonine kinase, putative (.1) AT1G66930 39 / 7e-05 Protein kinase superfamily protein (.1) AT4G18250 39 / 7e-05 receptor serine/threonine kinase, putative (.1) AT1G67000 38 / 0.0001 Protein kinase superfamily protein (.1) AT5G38260 36 / 0.0006 Protein kinase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008335 [exp] 54 / 5e-10 AT1G70250 316 / 8e-98 receptor serine/threonine kinase, putative (.1) Lus10022359 [exp] 51 / 5e-09 AT1G66980 322 / 3e-101 Glycerophosphodiester phosphodiesterase \(GDPD\) like 2, suppressor of npr1-1 constitutive 4 (.1) Lus10027085 [exp] 49 / 2e-08 AT1G66980 275 / 1e-84 Glycerophosphodiester phosphodiesterase \(GDPD\) like 2, suppressor of npr1-1 constitutive 4 (.1) Lus10025549 [exp] 48 / 4e-08 AT1G66980 209 / 1e-62 Glycerophosphodiester phosphodiesterase \(GDPD\) like 2, suppressor of npr1-1 constitutive 4 (.1) Lus10025545 [exp] 47 / 1e-07 AT5G39020 316 / 1e-101 Malectin/receptor-like protein kinase family protein (.1) Lus10025544 [exp] 46 / 3e-07 AT5G39020 217 / 1e-62 Malectin/receptor-like protein kinase family protein (.1) Lus10025492 [exp] 45 / 7e-07 AT5G38260 326 / 1e-102 Protein kinase superfamily protein (.1) Lus10025555 [exp] 42 / 1e-06 AT1G70250 84 / 2e-20 receptor serine/threonine kinase, putative (.1) Lus10027006 [exp] 42 / 6e-06 AT1G66980 218 / 1e-66 Glycerophosphodiester phosphodiesterase \(GDPD\) like 2, suppressor of npr1-1 constitutive 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G054550 [exp] 36 / 0.0006 AT1G67000 390 / 2e-124 Protein kinase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10008361 pacid=23178455 polypeptide=Lus10008361 locus=Lus10008361.g ID=Lus10008361.BGIv1.0 annot-version=v1.0 ATGGTGATTGTAGGGTTGTGGTGCATCCAGACGAATCGTGAGAGTCGTCCTCCTATGAACAAAGTGGTGTCGCTTGAAGGAGAGCTGGAAAGCTTACCAC TGCCTCCTAGACCTGTGTTGTTTGCTGGAGAAAACATCGAAGAAGGATCATCATCGGGTTTTGTGCCATTGCAGTCTACAGAACCAATCGGTAAAGTAGA CGGACAGTAA
AA sequence Show only first row Show all	>Lus10008361 pacid=23178455 polypeptide=Lus10008361 locus=Lus10008361.g ID=Lus10008361.BGIv1.0 annot-version=v1.0 MVIVGLWCIQTNRESRPPMNKVVSLEGELESLPLPPRPVLFAGENIEEGSSSGFVPLQSTEPIGKVDGQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G70250			receptor serine/threonine kina...		Lus10008361 [exp]	0	1
AT2G41200			unknown protein		Lus10008568 [exp]	3.7	0.8677
					Lus10007510 [exp]	6.7	0.7868
AT1G70520		ASG6, CRK2	ALTERED SEED GERMINATION 6, cy...		Lus10010960 [exp]	6.8	0.8377
AT5G65550			UDP-Glycosyltransferase superf...		Lus10008956 [exp]	7.1	0.8344
AT1G66980		GDPDL2, SNC4	Glycerophosphodiester phosphod...		Lus10022359 [exp]	8.1	0.8161
AT5G45890		SAG12	senescence-associated gene 12 ...		Lus10020722 [exp]	9.8	0.7928
AT2G16730		BGAL13	beta-galactosidase 13, glycosy...		Lus10020877 [exp]	10.0	0.8266
AT4G08250	GRAS		GRAS family transcription fact...		Lus10022664 [exp]	12.0	0.7943
AT5G22260		MS1	male sterility 1, RING/FYVE/PH...		Lus10013251 [exp]	13.4	0.7944
AT5G22260		MS1	male sterility 1, RING/FYVE/PH...		Lus10030773 [exp]	13.4	0.7964

Compare expression of checked genes

Lus10008361 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.