Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G08960 94 / 1e-23 ARM repeat superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004753 [exp] 121 / 2e-33 AT3G08960 1432 / 0.0 ARM repeat superfamily protein (.1) Lus10007842 [exp] 107 / 2e-28 AT3G08960 1493 / 0.0 ARM repeat superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G119900 [exp] 95 / 4e-24 AT3G08960 1547 / 0.0 ARM repeat superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10008367 pacid=23145291 polypeptide=Lus10008367 locus=Lus10008367.g ID=Lus10008367.BGIv1.0 annot-version=v1.0 ATGGCGCTATCGACTTCCGATTTGCCAGCGATATACTCGCTGCTGACGAATTCCATGAGCGGCGTTGTGAGCGTGCAGAGGCCAGCTGAGGCCGCGCTGT TGCAGTCCGAGAGGAGGCCTGGTTACTGCTCATGCTTGATGGAAGTGATAATCGCGAAGGATTTAGCAACGCAAGTTGGCGTTAGGTTGAAAGAATTGCT TGACAAAACGTCTCGAAGTTTCTCCTCCGTTGAGCTGACTCGCTTCTCCATTCCGATCCACAGAACTCAACGAGCTCTTTTGTGTTTTATTTGGACAGAT TGA
AA sequence Show only first row Show all	>Lus10008367 pacid=23145291 polypeptide=Lus10008367 locus=Lus10008367.g ID=Lus10008367.BGIv1.0 annot-version=v1.0 MALSTSDLPAIYSLLTNSMSGVVSVQRPAEAALLQSERRPGYCSCLMEVIIAKDLATQVGVRLKELLDKTSRSFSSVELTRFSIPIHRTQRALLCFIWTD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G08960			ARM repeat superfamily protein...		Lus10008367 [exp]	0	1
AT3G51770		ATEOL1, ETO1	ARABIDOPSIS ETHYLENE OVERPRODU...		Lus10010041 [exp]	1.4	0.8002
AT3G49990			unknown protein		Lus10015447 [exp]	13.5	0.7659
AT3G47570			Leucine-rich repeat protein ki...		Lus10038598 [exp]	26.0	0.7631
AT5G53150			DNAJ heat shock N-terminal dom...		Lus10028842 [exp]	33.7	0.7465
AT5G10940		ASG2	ALTERED SEED GERMINATION 2, tr...		Lus10040537 [exp]	34.4	0.7608
AT1G62680			Pentatricopeptide repeat (PPR)...		Lus10025942 [exp]	34.6	0.7421
AT5G22730			F-box/RNI-like/FBD-like domain...		Lus10035308 [exp]	50.1	0.7137
AT5G10370			helicase domain-containing pro...		Lus10012750 [exp]	60.8	0.7275
AT3G51770		ATEOL1, ETO1	ARABIDOPSIS ETHYLENE OVERPRODU...		Lus10012472 [exp]	84.0	0.7000
AT2G45880	BZR	BAM7, BMY4	BETA-AMYLASE 4, beta-amylase 7...		Lus10017819 [exp]	87.7	0.6856

Compare expression of checked genes

Lus10008367 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.