Lus10008370 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003175 51 / 7e-10 ND /
Lus10010057 53 / 1e-09 ND /
Lus10015969 45 / 2e-07 ND /
Lus10012269 38 / 0.0004 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10008370 pacid=23145290 polypeptide=Lus10008370 locus=Lus10008370.g ID=Lus10008370.BGIv1.0 annot-version=v1.0
ATGGGATGTGCAGTGTCTTACTCGAGTGTCAAAAATGGAAGCATGGCTCGGGCTAGCACTATTGCGAGTGGCACCGGCTCATGGGATAGAGTTCATGGTG
TGCTCCTTCAAACCGGTTCCTCTTCCGATAGGACGGCCACTGATTTCGCTACCGAAAACTCTCAGCTACATGCACTTGTCATGGACCAAGGTATAAAGCT
CGAGAATATTGATGTGAGTTTTGCCATGGTATGTGCTCGTACGCATCTTCCTCTGGGAGGGAACCCTCCTAGCAAGAAAACAAGGTGA
AA sequence
>Lus10008370 pacid=23145290 polypeptide=Lus10008370 locus=Lus10008370.g ID=Lus10008370.BGIv1.0 annot-version=v1.0
MGCAVSYSSVKNGSMARASTIASGTGSWDRVHGVLLQTGSSSDRTATDFATENSQLHALVMDQGIKLENIDVSFAMVCARTHLPLGGNPPSKKTR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10008370 0 1

Lus10008370 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.