Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G02050 103 / 1e-27 STP7 sugar transporter protein 7 (.1) AT1G77210 91 / 3e-23 AtSTP14 sugar transport protein 14, sugar transporter 14 (.1.2) AT5G26340 84 / 1e-20 ATSTP13, MSS1, STP13 SUGAR TRANSPORT PROTEIN 13, Major facilitator superfamily protein (.1) AT3G19940 82 / 4e-20 Major facilitator superfamily protein (.1) AT1G50310 79 / 4e-19 ATSTP9 sugar transporter 9 (.1) AT5G26250 72 / 2e-16 Major facilitator superfamily protein (.1) AT1G07340 71 / 3e-16 ATSTP2 sugar transporter 2 (.1) AT5G23270 70 / 8e-16 ATSTP11, STP11 sugar transporter 11 (.1) AT3G19930 70 / 1e-15 ATSTP4, STP4 sugar transporter 4 (.1) AT3G05960 69 / 2e-15 ATSTP6 sugar transporter 6 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021723 [exp] 122 / 3e-37 AT4G02050 212 / 5e-67 sugar transporter protein 7 (.1) Lus10019070 [exp] 124 / 8e-36 AT4G02050 538 / 0.0 sugar transporter protein 7 (.1) Lus10036325 [exp] 125 / 2e-35 AT4G02050 801 / 0.0 sugar transporter protein 7 (.1) Lus10022421 [exp] 89 / 3e-22 AT1G77210 790 / 0.0 sugar transport protein 14, sugar transporter 14 (.1.2) Lus10010534 [exp] 80 / 4e-19 AT5G26340 902 / 0.0 SUGAR TRANSPORT PROTEIN 13, Major facilitator superfamily protein (.1) Lus10002450 [exp] 80 / 4e-19 AT5G26340 905 / 0.0 SUGAR TRANSPORT PROTEIN 13, Major facilitator superfamily protein (.1) Lus10013441 [exp] 77 / 2e-18 AT1G50310 731 / 0.0 sugar transporter 9 (.1) Lus10021924 [exp] 76 / 8e-18 AT5G26340 832 / 0.0 SUGAR TRANSPORT PROTEIN 13, Major facilitator superfamily protein (.1) Lus10040993 [exp] 76 / 1e-17 AT1G50310 601 / 0.0 sugar transporter 9 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G113300 [exp] 110 / 3e-30 AT4G02050 821 / 0.0 sugar transporter protein 7 (.1) Potri.006G189100 [exp] 107 / 3e-29 AT4G02050 821 / 0.0 sugar transporter protein 7 (.1) Potri.001G253800 [exp] 94 / 2e-24 AT1G77210 737 / 0.0 sugar transport protein 14, sugar transporter 14 (.1.2) Potri.018G085200 [exp] 91 / 4e-23 AT1G77210 771 / 0.0 sugar transport protein 14, sugar transporter 14 (.1.2) Potri.009G048500 [exp] 89 / 8e-23 AT1G77210 516 / 0.0 sugar transport protein 14, sugar transporter 14 (.1.2) Potri.010G090000 [exp] 85 / 3e-21 AT5G26250 664 / 0.0 Major facilitator superfamily protein (.1) Potri.007G073900 [exp] 83 / 2e-20 AT3G19940 706 / 0.0 Major facilitator superfamily protein (.1) Potri.007G073850 [exp] 83 / 2e-20 AT3G19940 699 / 0.0 Major facilitator superfamily protein (.1) Potri.007G073800 [exp] 83 / 2e-20 AT3G19940 699 / 0.0 Major facilitator superfamily protein (.1) Potri.005G090700 [exp] 83 / 2e-20 AT3G19940 710 / 0.0 Major facilitator superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0015 [flax] [poplar] MFS PF00083 [flax] [poplar] Sugar_tr Sugar (and other) transporter
Representative CDS sequence Show only first row Show all	>Lus10008372 pacid=23145292 polypeptide=Lus10008372 locus=Lus10008372.g ID=Lus10008372.BGIv1.0 annot-version=v1.0 ATGGTTAATTATGGAACACATAAGCTTGAGCCTTATGGTTGGAGGCTAACATTGGGATTGGCAGCAGTTCCAACTTTGTTAATGGCACTAGGTGGAATGC TGCTTCATGAGACACCTAATAGTTTGATTGAAAGAGGGTTAGAAGAGAAAGGAAGTATGGTGCTAGATAAAATCATAGGAACAACCAATGTAGAAGCAGA ATTAGAGGATATGGAGTGA
AA sequence Show only first row Show all	>Lus10008372 pacid=23145292 polypeptide=Lus10008372 locus=Lus10008372.g ID=Lus10008372.BGIv1.0 annot-version=v1.0 MVNYGTHKLEPYGWRLTLGLAAVPTLLMALGGMLLHETPNSLIERGLEEKGSMVLDKIIGTTNVEAELEDME

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G02050		STP7	sugar transporter protein 7 (....		Lus10008372 [exp]	0	1
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10008919 [exp]	2.0	1.0000
AT2G26490			Transducin/WD40 repeat-like su...		Lus10016289 [exp]	2.8	1.0000
AT3G47570			Leucine-rich repeat protein ki...		Lus10030856 [exp]	3.5	0.9100
AT5G09360		LAC14	laccase 14 (.1)		Lus10036070 [exp]	3.5	1.0000
AT3G18080		BGLU44	B-S glucosidase 44 (.1)		Lus10017997 [exp]	4.0	1.0000
AT1G08080		ATACA7, ACA7	A. THALIANA ALPHA CARBONIC ANH...		Lus10021456 [exp]	5.0	0.9956
					Lus10014629 [exp]	5.3	0.9709
AT2G18370			Bifunctional inhibitor/lipid-t...		Lus10042512 [exp]	5.5	0.9491
AT1G55790			Domain of unknown function (DU...		Lus10032900 [exp]	5.5	0.9846
					Lus10032804 [exp]	6.3	0.9674

Compare expression of checked genes

Lus10008372 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.