Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G08465 85 / 9e-21 YABBY YAB2 YABBY2, Plant-specific transcription factor YABBY family protein (.1) AT2G26580 84 / 9e-21 YABBY YAB5 YABBY5, plant-specific transcription factor YABBY family protein (.1.2) AT2G45190 83 / 1e-19 YABBY FIL, YAB1, AFO YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) AT4G00180 79 / 2e-18 YABBY YAB3 YABBY3, Plant-specific transcription factor YABBY family protein (.1.2) AT1G69180 75 / 3e-17 YABBY CRC CRABS CLAW, Plant-specific transcription factor YABBY family protein (.1) AT1G23420 69 / 2e-14 YABBY INO, YAB4 INNER NO OUTER, Plant-specific transcription factor YABBY family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043004 [exp] 114 / 8e-31 ND 47 / 8e-06 Lus10019613 [exp] 105 / 3e-29 ND / Lus10006476 [exp] 100 / 6e-27 ND / Lus10026462 [exp] 97 / 6e-25 ND / Lus10033056 [exp] 85 / 2e-21 ND / Lus10019407 [exp] 85 / 1e-20 AT2G26580 228 / 8e-77 YABBY5, plant-specific transcription factor YABBY family protein (.1.2) Lus10032240 [exp] 85 / 2e-20 AT2G45190 193 / 1e-61 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Lus10024603 [exp] 85 / 2e-20 AT2G45190 190 / 2e-60 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Lus10043264 [exp] 87 / 6e-20 AT5G35410 630 / 0.0 SNF1-RELATED PROTEIN KINASE 3.11, CBL-INTERACTING PROTEIN KINASE 24, SALT OVERLY SENSITIVE 2, Protein kinase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G214700 [exp] 88 / 8e-22 AT1G08465 183 / 8e-59 YABBY2, Plant-specific transcription factor YABBY family protein (.1) Potri.009G000100 [exp] 86 / 2e-21 AT1G08465 215 / 3e-72 YABBY2, Plant-specific transcription factor YABBY family protein (.1) Potri.006G067800 [exp] 85 / 1e-20 AT2G26580 253 / 5e-87 YABBY5, plant-specific transcription factor YABBY family protein (.1.2) Potri.018G129800 [exp] 82 / 5e-20 AT2G26580 250 / 5e-86 YABBY5, plant-specific transcription factor YABBY family protein (.1.2) Potri.001G120200 [exp] 83 / 6e-20 AT2G45190 236 / 4e-79 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Potri.014G066700 [exp] 83 / 6e-20 AT2G45190 277 / 3e-95 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Potri.003G112800 [exp] 83 / 6e-20 AT2G45190 243 / 1e-81 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Potri.002G145100 [exp] 81 / 4e-19 AT2G45190 265 / 2e-90 YABBY1, FILAMENTOUS FLOWER, ABNORMAL FLORAL ORGANS, Plant-specific transcription factor YABBY family protein (.1) Potri.010G154350 [exp] 75 / 5e-17 AT1G69180 155 / 2e-48 CRABS CLAW, Plant-specific transcription factor YABBY family protein (.1) Potri.008G189000 [exp] 75 / 6e-17 AT1G23420 213 / 7e-70 INNER NO OUTER, Plant-specific transcription factor YABBY family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0114 [flax] [poplar] HMG-box PF04690 [flax] [poplar] YABBY YABBY protein
Representative CDS sequence Show only first row Show all	>Lus10008374 pacid=23145274 polypeptide=Lus10008374 locus=Lus10008374.g ID=Lus10008374.BGIv1.0 annot-version=v1.0 ATGAAAAGAAGAACAGATTTAAGAGCTCCGGAGAAGCGCCAGCGTGTTCCTTCTGCCTATAACAGGTTCATTAAAGAGGAGATCCAAAGGATTAAAACTA GTAATCCTGACATTACCCACAGGGAAGCTTTCAGCACCGCAGCTAAGAATATCTTACTATACTATGGGGAAAGAATCGGTCAAACACCAAGTAGGGGAGT TCCCAAACACATCACCCCTGATGATTCGCTTGGTCGTGTCAAAGGAGTCGAGCATAGTGGCCAAGTGTCTAGAGTAGGATATGGAGTAACTCCTTCTCAT GTTGGACTAAGTAGGAAGGGTAAAGGCATTGGACAGTCTAGTTTAGACGGTCGTCAATCCCATTTTCATCTCCTAGGGCATTGTCCTACCACATCGATGG CACTAGATCGTGTGAATGTTTTGGGAGAAGAAATTCGCTTGATGAGAGAAGAAATGGAACGAGGAAAGCAACAAGTGCAAGAAGATGAAGAGGAACAAGA AGACGAGGAGGAAGATGATTTTGATTATTAA
AA sequence Show only first row Show all	>Lus10008374 pacid=23145274 polypeptide=Lus10008374 locus=Lus10008374.g ID=Lus10008374.BGIv1.0 annot-version=v1.0 MKRRTDLRAPEKRQRVPSAYNRFIKEEIQRIKTSNPDITHREAFSTAAKNILLYYGERIGQTPSRGVPKHITPDDSLGRVKGVEHSGQVSRVGYGVTPSH VGLSRKGKGIGQSSLDGRQSHFHLLGHCPTTSMALDRVNVLGEEIRLMREEMERGKQQVQEDEEEQEDEEEDDFDY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G08465	YABBY	YAB2	YABBY2, Plant-specific transcr...		Lus10008374 [exp]	0	1
AT3G52610			unknown protein		Lus10022698 [exp]	1.7	0.9951
AT1G78955		CAMS1	camelliol C synthase 1 (.1)		Lus10026079 [exp]	3.9	0.9931
AT5G61850	LFY	LFY3, LFY	LEAFY 3, floral meristem ident...		Lus10022427 [exp]	8.2	0.9950
AT2G23945			Eukaryotic aspartyl protease f...		Lus10015487 [exp]	8.6	0.9007
AT1G69120	MADS	AGL7, AP1	APETALA1, AGAMOUS-like 7, K-bo...		Lus10004637 [exp]	12.2	0.9912
AT1G47840		HXK3	hexokinase 3 (.1)		Lus10035793 [exp]	12.6	0.9831
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Lus10010759 [exp]	13.6	0.9874
AT3G02310	MADS	AGL4, SEP2	SEPALLATA 2, AGAMOUS-like 4, K...		Lus10005080 [exp]	13.8	0.9906
AT1G37140		MCT1	MEI2 C-terminal RRM only like ...		Lus10018195 [exp]	15.0	0.9741
AT5G15800	MADS	AGL2, SEP1	SEPALLATA1, AGAMOUS-like 2, K-...		Lus10034663 [exp]	15.1	0.9903

Compare expression of checked genes

Lus10008374 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.