Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033901 [exp] 90 / 4e-25 ND / Lus10034725 [exp] 66 / 3e-15 ND / Lus10019381 [exp] 64 / 3e-14 ND / Lus10016935 [exp] 63 / 5e-14 ND / Lus10008802 [exp] 62 / 2e-13 ND / Lus10029652 [exp] 59 / 1e-11 ND / Lus10009722 [exp] 57 / 6e-11 AT3G20300 626 / 0.0 Protein of unknown function (DUF3537) (.1) Lus10026801 [exp] 57 / 8e-11 AT5G24530 142 / 7e-38 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10032678 [exp] 56 / 1e-10 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10008385 pacid=23152649 polypeptide=Lus10008385 locus=Lus10008385.g ID=Lus10008385.BGIv1.0 annot-version=v1.0 ATGGAAGGTCACCACACACACTATGATTGTTATCTTGATGCCGACTGTATGAAGGTTGCACAGTTCAATTGGGGTAAGTATGTGGTTGACACACTTGTTA AAGGGATGACTGATTTCATCCAAGGAAACATGAAGTCAACATATCCCAGCGGGGATATGAACTTCATGGTGTATGCCAAGCAGTTGGAAGTCCTCCAAAG AGTTTCAGCCGACAAGGTTAGCAAACAGAAGGTAGGCCTCGAAACTTAG
AA sequence Show only first row Show all	>Lus10008385 pacid=23152649 polypeptide=Lus10008385 locus=Lus10008385.g ID=Lus10008385.BGIv1.0 annot-version=v1.0 MEGHHTHYDCYLDADCMKVAQFNWGKYVVDTLVKGMTDFIQGNMKSTYPSGDMNFMVYAKQLEVLQRVSADKVSKQKVGLET

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10008385 [exp]	0	1
AT1G08510		FATB	fatty acyl-ACP thioesterases B...		Lus10025763 [exp]	8.7	0.9921
AT5G37820		NIP4;2, NLM5	NODULIN- 26-LIKE MAJOR INTRINS...		Lus10025744 [exp]	10.2	0.8861
AT2G20420			ATP citrate lyase (ACL) family...		Lus10022902 [exp]	12.2	0.9921
AT1G01490			Heavy metal transport/detoxifi...		Lus10024670 [exp]	13.7	0.9126
AT5G66520			Tetratricopeptide repeat (TPR)...		Lus10036421 [exp]	13.9	0.9006
AT4G18840			Pentatricopeptide repeat (PPR-...		Lus10036420 [exp]	14.2	0.8945
AT5G42870		ATPAH2	phosphatidic acid phosphohydro...		Lus10021733 [exp]	15.0	0.9921
AT3G15670			Late embryogenesis abundant pr...		Lus10004395 [exp]	15.4	0.9705
AT1G29010			unknown protein		Lus10013977 [exp]	15.5	0.9525
					Lus10029617 [exp]	16.2	0.9203

Compare expression of checked genes

Lus10008385 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.