Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006016 [exp] 50 / 6e-09 AT3G13898 76 / 4e-17 unknown protein
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10008388 pacid=23152641 polypeptide=Lus10008388 locus=Lus10008388.g ID=Lus10008388.BGIv1.0 annot-version=v1.0 ATGGCAGACAACGGTTCTTTCTTTGATGATATAATGAAATGGACGGTCCAGATTGGTGTTTCCCCACCCACCAAGCTGCCTATGGAAAACTGGGTCACTG CAACTGGATTTTCTTTCTTCCGATTCATGGGAATGAAACTCTCAGAGATCAAAAGGGGCTCTGCAGTCTAG
AA sequence Show only first row Show all	>Lus10008388 pacid=23152641 polypeptide=Lus10008388 locus=Lus10008388.g ID=Lus10008388.BGIv1.0 annot-version=v1.0 MADNGSFFDDIMKWTVQIGVSPPTKLPMENWVTATGFSFFRFMGMKLSEIKRGSAV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10008388 [exp]	0	1
AT5G45110		ATNPR3, NPR3	NPR1-like protein 3 (.1)		Lus10036200 [exp]	2.6	0.8710
AT3G29000			Calcium-binding EF-hand family...		Lus10019090 [exp]	4.7	0.8267
AT1G26660			Prefoldin chaperone subunit fa...		Lus10026631 [exp]	5.7	0.8266
AT5G08490		SLG1	SLOW GROWTH 1, Tetratricopepti...		Lus10014828 [exp]	8.5	0.8213
AT1G25260			Ribosomal protein L10 family p...		Lus10001072 [exp]	12.6	0.8133
AT5G23510			unknown protein		Lus10029154 [exp]	17.7	0.8050
AT1G60670			Protein of unknown function (D...		Lus10013072 [exp]	18.7	0.8069
AT3G18380		SHH2	SAWADEE homeodomain homolog 2,...		Lus10005480 [exp]	19.6	0.7987
AT3G24560		RSY3	RASPBERRY 3, Adenine nucleotid...		Lus10035028 [exp]	21.2	0.7989
AT3G52120			SWAP (Suppressor-of-White-APri...		Lus10037485 [exp]	21.9	0.8075

Compare expression of checked genes

Lus10008388 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.