Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G27130 72 / 1e-16 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G43720 65 / 9e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT3G22600 64 / 2e-13 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G13820 61 / 7e-13 AtXYP2 xylogen protein 2, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT2G48130 58 / 3e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G08670 59 / 4e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G14815 57 / 4e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G64080 48 / 1e-07 AtXYP1 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT1G03103 47 / 3e-07 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G55260 47 / 8e-07 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026768 [exp] 189 / 4e-63 AT2G27130 81 / 4e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10008401 [exp] 136 / 2e-41 AT3G43720 91 / 1e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10026769 [exp] 133 / 4e-40 AT3G43720 93 / 1e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10001153 [exp] 100 / 8e-27 AT3G43720 105 / 1e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10014681 [exp] 67 / 1e-14 AT3G22600 126 / 3e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10021604 [exp] 66 / 4e-14 AT5G64080 142 / 4e-43 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10041197 [exp] 66 / 5e-14 AT3G22600 117 / 9e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10021912 [exp] 65 / 9e-14 AT3G22600 125 / 7e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10039348 [exp] 63 / 5e-13 AT3G22600 163 / 7e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G158100 [exp] 80 / 2e-19 AT3G43720 106 / 5e-29 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.004G196000 [exp] 77 / 4e-18 AT3G43720 94 / 1e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.003G020200 [exp] 65 / 7e-14 AT5G64080 121 / 5e-35 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.010G085400 [exp] 64 / 1e-13 AT3G22600 140 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.008G155100 [exp] 63 / 4e-13 AT3G22600 149 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G210100 [exp] 57 / 1e-10 AT5G64080 118 / 7e-34 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.002G050400 [exp] 54 / 1e-09 AT3G22600 100 / 1e-26 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.005G211800 [exp] 50 / 2e-08 AT3G22600 160 / 6e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.002G050500 [exp] 49 / 9e-08 AT3G22600 129 / 2e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.002G050300 [exp] 46 / 1e-06 AT3G22600 117 / 3e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10008400 pacid=23163486 polypeptide=Lus10008400 locus=Lus10008400.g ID=Lus10008400.BGIv1.0 annot-version=v1.0 ATGTCTCGCCATTACCCAACAACCGCCCTCATCACCATCGCCGCCGTCATCGCCATCTCGGCCGCCGTCTCCGCCGCCCAGACGCCGACCATGGCTCCAA TGATCCCCGCCGCCGACTCTACTTCGCCGGCGCCATCTCCATCTCCGGACTGCTTAACCCAGCTACTGACACTGTCAGACTGCTTGTCGTACGTTTTAAA AGACAGCAACGAGACCAAACCGGACAAGGCTTGCTGCCCGGAGCTGGCCGATCTGGTCGGAAACTACCCAACTTGCCTTTGCACGCTCTTCACACTTGAC GCCTCGTCGTACGGACTGGAAGTTGACTACGGCAGAGCTTTTGGTCTCCCTTCCGCCTGCTCCATCTCCGTTCCTCCCGCCGTTACCTCCTGCGTCCGCG GTAAAACACTTAACTAA
AA sequence Show only first row Show all	>Lus10008400 pacid=23163486 polypeptide=Lus10008400 locus=Lus10008400.g ID=Lus10008400.BGIv1.0 annot-version=v1.0 MSRHYPTTALITIAAVIAISAAVSAAQTPTMAPMIPAADSTSPAPSPSPDCLTQLLTLSDCLSYVLKDSNETKPDKACCPELADLVGNYPTCLCTLFTLD ASSYGLEVDYGRAFGLPSACSISVPPAVTSCVRGKTLN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G43720			Bifunctional inhibitor/lipid-t...		Lus10008400 [exp]	0	1
AT4G27990		ATYLMG1-2	YGGT family protein (.1)		Lus10020405 [exp]	2.4	0.9164
AT4G11175			Nucleic acid-binding, OB-fold-...		Lus10037352 [exp]	5.3	0.9004
AT3G23760			unknown protein		Lus10032527 [exp]	6.9	0.9055
AT3G23760			unknown protein		Lus10043212 [exp]	8.1	0.8970
AT2G26900		BASS2	bile acid:sodium symporter fam...		Lus10007016 [exp]	9.5	0.9055
AT4G27990		ATYLMG1-2	YGGT family protein (.1)		Lus10009586 [exp]	11.7	0.8803
					Lus10029272 [exp]	12.7	0.8505
AT4G11175			Nucleic acid-binding, OB-fold-...		Lus10035773 [exp]	13.0	0.8909
AT2G29180			unknown protein		Lus10016512 [exp]	15.0	0.8820
AT5G48910		LPA66	LOW PSII ACCUMULATION 66, Pent...		Lus10010908 [exp]	16.4	0.8544

Compare expression of checked genes

Lus10008400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.