Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G27130 79 / 3e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G43720 75 / 7e-17 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT2G13820 68 / 1e-14 AtXYP2 xylogen protein 2, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT4G08670 64 / 2e-12 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G22600 59 / 4e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G36150 58 / 3e-10 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G64080 54 / 3e-09 AtXYP1 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT2G48130 52 / 2e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G03103 50 / 7e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G14815 47 / 6e-07 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026769 [exp] 206 / 8e-68 AT3G43720 93 / 1e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10026768 [exp] 145 / 8e-45 AT2G27130 81 / 4e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10008400 [exp] 138 / 5e-42 AT3G43720 76 / 6e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10001153 [exp] 110 / 3e-30 AT3G43720 105 / 1e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10014681 [exp] 68 / 3e-14 AT3G22600 126 / 3e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10041197 [exp] 65 / 4e-13 AT3G22600 117 / 9e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10021912 [exp] 65 / 5e-13 AT3G22600 125 / 7e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10021604 [exp] 63 / 4e-12 AT5G64080 142 / 4e-43 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10039348 [exp] 59 / 4e-11 AT3G22600 163 / 7e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G196000 [exp] 80 / 2e-18 AT3G43720 94 / 1e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.009G158100 [exp] 77 / 9e-18 AT3G43720 106 / 5e-29 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.010G085400 [exp] 62 / 3e-12 AT3G22600 140 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.008G155100 [exp] 61 / 7e-12 AT3G22600 149 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G020200 [exp] 59 / 4e-11 AT5G64080 121 / 5e-35 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.001G210100 [exp] 53 / 9e-09 AT5G64080 118 / 7e-34 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.002G050400 [exp] 50 / 1e-07 AT3G22600 100 / 1e-26 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.005G169000 [exp] 49 / 3e-07 AT5G64080 86 / 7e-21 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.001G232000 [exp] 46 / 4e-06 AT2G44300 179 / 4e-57 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.002G092800 [exp] 45 / 7e-06 AT5G64080 84 / 3e-20 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10008401 pacid=23163464 polypeptide=Lus10008401 locus=Lus10008401.g ID=Lus10008401.BGIv1.0 annot-version=v1.0 ATGTCTCACCAGCACTACCCAACAACCACCCTCGTCATCATCGCCGCCGCCATCACCATTTCGGCCGCCCAGACGATGACGATGGCTCCAAGCCCCTCCT TCGAGTCGCCGGTGGACTGCGAGGCGCAGCTAATGAACCTGTCAGACTGCTTGTCGTACGTGCTGGTAGGGAGCAAGGACACCAAACCGGACAAGGCTTG CTGCCCGGAGCTGGCCGGGCTGCTTGGAAGCTACCCGACCTGCCTATGTACGGTTCTGACGATTAACGCCTCCTCGTATGGACTGGAAATTGACTACGGT AGAGCGTTTGGGCTCCCTTCGTTATGCTCCTTCTCCGTTCCTCCCGCCGTTACCTCCTGCGCCCGTGAAGCTAATGTTCCGGTTGGGGCTCCGTCGCCAA GCCAAGGAGGAGGCGCGGCGGGACCAGGCAGCGGAGAAGGAGGGATGATGGCACCTTCACCTGCAAACAATGAGACCACCGGCGGCGGTGGAGGATCAGG AGGTTCGAGCCATGGCTCACCAAAGGCGCCCGTTTCAAAACTTGCTACACAGTTGCTCTCTATGCTGGTGCTACCACTGGTTTCCTACTTGTGGTGA
AA sequence Show only first row Show all	>Lus10008401 pacid=23163464 polypeptide=Lus10008401 locus=Lus10008401.g ID=Lus10008401.BGIv1.0 annot-version=v1.0 MSHQHYPTTTLVIIAAAITISAAQTMTMAPSPSFESPVDCEAQLMNLSDCLSYVLVGSKDTKPDKACCPELAGLLGSYPTCLCTVLTINASSYGLEIDYG RAFGLPSLCSFSVPPAVTSCAREANVPVGAPSPSQGGGAAGPGSGEGGMMAPSPANNETTGGGGGSGGSSHGSPKAPVSKLATQLLSMLVLPLVSYLW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G43720			Bifunctional inhibitor/lipid-t...		Lus10008401 [exp]	0	1
AT1G53280		AtDJ1B	DJ-1 homolog B, Class I glutam...		Lus10009525 [exp]	2.0	0.8757
AT3G57120			Protein kinase superfamily pro...		Lus10021451 [exp]	3.5	0.8591
AT4G34120		CBSX2, CDCP1, L...	LOSS OF THE TIMING OF ET AND J...		Lus10027885 [exp]	5.1	0.8747
AT2G21170		PDTPI, TIM	PLASTID ISOFORM TRIOSE PHOSPHA...		Lus10007575 [exp]	8.2	0.8586
AT2G37400			Tetratricopeptide repeat (TPR)...		Lus10025299 [exp]	14.0	0.8430
AT2G21860			violaxanthin de-epoxidase-rela...		Lus10032756 [exp]	14.7	0.8451
AT5G43050		NPQ6	NONPHOTOCHEMICAL QUENCHING 6, ...		Lus10038888 [exp]	15.5	0.8316
AT2G30360		PKS5, CIPK11, S...	SNF1-RELATED PROTEIN KINASE 3....		Lus10022748 [exp]	15.9	0.8396
AT5G37980			Zinc-binding dehydrogenase fam...		Lus10004380 [exp]	17.6	0.8527
AT5G55190		RAN3, ATRAN3	RAN GTPase 3 (.1)		Lus10019441 [exp]	20.1	0.8358

Compare expression of checked genes

Lus10008401 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.