Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026771 [exp] 62 / 1e-12 AT4G10950 199 / 8e-60 SGNH hydrolase-type esterase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G157800 [exp] 39 / 0.0001 AT4G10950 233 / 5e-73 SGNH hydrolase-type esterase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10008404 pacid=23163501 polypeptide=Lus10008404 locus=Lus10008404.g ID=Lus10008404.BGIv1.0 annot-version=v1.0 ATGGCCTGCAATCTAACTTCATCACCACACGTGTGGTGGGATCTCTACAATCCTACTCAGCTAGTGAACTCAGTTCTTGCCGATTCAGTTTGGTCTGCTG ATGCTGATGATGTAAGTTCTGCTTCTTTCAGCATCTGCCATCCTAGTTCAGTAAAGGGATTGGCTTCTTTCCCTTCTCACGTGCCCTATAAAATCCTAGT TAATCAAGAGTGTTGTTTGTTTGACTCAGCGACGACGGTAAAAGCAACAACACCCCCCCGCCCAATACAATTGCCGTTTCCTTGA
AA sequence Show only first row Show all	>Lus10008404 pacid=23163501 polypeptide=Lus10008404 locus=Lus10008404.g ID=Lus10008404.BGIv1.0 annot-version=v1.0 MACNLTSSPHVWWDLYNPTQLVNSVLADSVWSADADDVSSASFSICHPSSVKGLASFPSHVPYKILVNQECCLFDSATTVKATTPPRPIQLPFP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G10950			SGNH hydrolase-type esterase s...		Lus10008404 [exp]	0	1
AT1G08710			F-box family protein (.1.2)		Lus10020340 [exp]	2.8	0.6146
AT5G56750		NDL1	N-MYC downregulated-like 1 (.1...		Lus10026433 [exp]	16.9	0.6365
AT4G10950			SGNH hydrolase-type esterase s...		Lus10008403 [exp]	28.2	0.5941
AT5G02910			F-box/RNI-like superfamily pro...		Lus10002819 [exp]	29.0	0.5726
AT3G49180		RID3	ROOT INITIATION DEFECTIVE 3, T...		Lus10015407 [exp]	29.6	0.5905
AT1G09790		COBL6	COBRA-like protein 6 precursor...		Lus10007217 [exp]	54.0	0.5696
AT2G38910		CPK20	calcium-dependent protein kina...		Lus10012285 [exp]	64.4	0.5608
AT1G79440		ENF1, SSADH1, A...	SUCCINIC SEMIALDEHYDE DEHYDROG...		Lus10002132 [exp]	72.9	0.5440
AT4G14590		EMB2739	embryo defective 2739 (.1)		Lus10009705 [exp]	80.5	0.5508
AT4G10950			SGNH hydrolase-type esterase s...		Lus10026771 [exp]	89.9	0.5050

Compare expression of checked genes

Lus10008404 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.