Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G36930 137 / 6e-38 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT1G72930 117 / 7e-34 TIR toll/interleukin-1 receptor-like (.1.2) AT1G72950 118 / 2e-32 Disease resistance protein (TIR-NBS class) (.1) AT1G72910 116 / 2e-31 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT1G72900 115 / 2e-31 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT1G72890 116 / 4e-31 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2) AT1G72920 112 / 7e-31 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT1G27170 117 / 8e-31 transmembrane receptors;ATP binding (.1.2) AT5G46450 114 / 9e-30 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G41750 114 / 1e-29 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001040 [exp] 262 / 1e-89 AT5G36930 167 / 2e-47 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10008027 [exp] 258 / 1e-87 AT5G36930 197 / 5e-57 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10026961 [exp] 274 / 1e-86 AT5G36930 420 / 2e-126 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10020533 [exp] 270 / 5e-85 AT1G27170 405 / 1e-122 transmembrane receptors;ATP binding (.1.2) Lus10020524 [exp] 268 / 2e-84 AT1G27170 395 / 9e-119 transmembrane receptors;ATP binding (.1.2) Lus10020534 [exp] 267 / 2e-83 AT5G36930 414 / 1e-124 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10020536 [exp] 261 / 1e-81 AT1G27170 392 / 8e-118 transmembrane receptors;ATP binding (.1.2) Lus10010574 [exp] 260 / 3e-81 AT5G36930 397 / 4e-119 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10035674 [exp] 258 / 4e-80 AT5G36930 410 / 1e-121 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G019710 [exp] 171 / 3e-51 AT5G36930 445 / 2e-144 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002568 [exp] 167 / 8e-50 AT5G36930 439 / 2e-142 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002200 [exp] 170 / 2e-49 AT5G36930 617 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.007G143100 [exp] 160 / 3e-49 AT5G36930 234 / 1e-69 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002428 [exp] 166 / 4e-49 AT5G36930 387 / 2e-122 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G017082 [exp] 167 / 2e-48 AT5G36930 638 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T001933 [exp] 167 / 2e-48 AT5G36930 617 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G046000 [exp] 164 / 4e-48 AT5G36930 496 / 1e-162 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002400 [exp] 165 / 9e-48 AT5G36930 658 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.003G014200 [exp] 164 / 3e-47 AT5G36930 673 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0173 [flax] [poplar] STIR PF01582 [flax] [poplar] TIR TIR domain
Representative CDS sequence Show only first row Show all	>Lus10008415 pacid=23163470 polypeptide=Lus10008415 locus=Lus10008415.g ID=Lus10008415.BGIv1.0 annot-version=v1.0 ATGACATCTAATAGCTCCTCCATTGATCCAGCTGTCCCTCTTCCAACTGGAGAGTATGAGGTTTTTTTGAGCTTTAGAGGCCCCGACGCCCGCCAAACAT TTGCTGATTGCCTGTACAACTCCCTTGTTCGTTCCAAGATTCGAACGTTTAGAGACGAGGAAGAGCTCCGAAGAGGGGAGACCATCGCTCCATCCCTTGT CAAGGCTATCACTGAATCCAAGACCTACATCCCCATCTTTACACAAAGCTATGCTTCCAGAAAATGGTGCCTTCAGGAGCTAGCTGAGATGGTGAAGTGC TGGAAGACTGGAAAAGGACACCTCATCCTCCCTATTTTCTATCTTATGGACCCTAGAGACGTGCGACATCAAGACACTGGTCCTTACAAGGAAGCATTTG AGCAACACAGCGTCAAGCATGACCCGAAAACTGTAATGGAATGGATGGAAGCACTCCAAGAGGTTGGAAGAATGAAAGGATGGCATCTCACCGAGTCAAA TGGGTAA
AA sequence Show only first row Show all	>Lus10008415 pacid=23163470 polypeptide=Lus10008415 locus=Lus10008415.g ID=Lus10008415.BGIv1.0 annot-version=v1.0 MTSNSSSIDPAVPLPTGEYEVFLSFRGPDARQTFADCLYNSLVRSKIRTFRDEEELRRGETIAPSLVKAITESKTYIPIFTQSYASRKWCLQELAEMVKC WKTGKGHLILPIFYLMDPRDVRHQDTGPYKEAFEQHSVKHDPKTVMEWMEALQEVGRMKGWHLTESNG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G36930			Disease resistance protein (TI...		Lus10008415 [exp]	0	1
AT1G59730		ATH7	thioredoxin H-type 7 (.1)		Lus10037227 [exp]	4.0	0.6543
AT2G31260		ATAPG9, APG9	autophagy 9 (APG9) (.1)		Lus10000709 [exp]	8.1	0.6965
AT2G23140			RING/U-box superfamily protein...		Lus10019306 [exp]	11.5	0.6062
AT2G24520		AHA5	H\(+\)-ATPase 5, H\(+\)-ATPase...		Lus10020147 [exp]	21.7	0.5829
AT3G30340			nodulin MtN21 /EamA-like trans...		Lus10030168 [exp]	22.1	0.5787
AT2G36800		UGT73C5, DOGT1	UDP-GLUCOSYL TRANSFERASE 73C5,...		Lus10023938 [exp]	25.7	0.5900
AT2G23755			unknown protein		Lus10000575 [exp]	26.1	0.5475
AT3G03380		DEG7, DEGP7	degradation of periplasmic pro...		Lus10017636 [exp]	31.4	0.5593
AT5G43370		PHT1;2, APT1, P...	ARABIDOPSIS PHOSPHATE TRANSPOR...		Lus10027631 [exp]	33.0	0.5565
					Lus10001193 [exp]	39.5	0.5180

Compare expression of checked genes

Lus10008415 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.