Lus10008425 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G52860 138 / 1e-42 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003357 193 / 2e-64 AT3G52860 174 / 8e-57 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G127900 162 / 3e-52 AT3G52860 142 / 5e-44 unknown protein
PFAM info
Representative CDS sequence
>Lus10008425 pacid=23163503 polypeptide=Lus10008425 locus=Lus10008425.g ID=Lus10008425.BGIv1.0 annot-version=v1.0
ATGGCTGAGAGGCAAGCTCTGGATCAACCACAGCAGCAGCAAGAGCTACAATCACCATCTCAGCAGAATCCCGAAGGAGAAGACATGATAGCTTGTGTAA
TGGCGTTAGAGGCTGCTTTGCTTCCATGCTTGCCCGCCAGGGAACTCCAAGCCATCGACCGGTGTCCCCACCCATCTCACCAGATTGATGTGGAGAGGCA
TGCAAGGGATTTCATGGAGGCTGCTAAGAAGCTTCAACTGTATTTCATCGGACTCCAGCGCGAAGACCAGCCTACCGCAGCTGGAAAGCTTAGAAAGGAG
ATTGCTGAAATGGAGGAAGAGTTGAAGACGAAAGACGAGCTTATCAAGAAGCAAGAGAGACTTATCAAGGGGTGGCGAAAAGATCTCGAGGAACAGTTGG
AGAAGCATAAGATTGAACTGGAGAGAGTATGA
AA sequence
>Lus10008425 pacid=23163503 polypeptide=Lus10008425 locus=Lus10008425.g ID=Lus10008425.BGIv1.0 annot-version=v1.0
MAERQALDQPQQQQELQSPSQQNPEGEDMIACVMALEAALLPCLPARELQAIDRCPHPSHQIDVERHARDFMEAAKKLQLYFIGLQREDQPTAAGKLRKE
IAEMEEELKTKDELIKKQERLIKGWRKDLEEQLEKHKIELERV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G52860 unknown protein Lus10008425 0 1
AT2G30070 ATKUP1, ATKT1P,... POTASSIUM UPTAKE TRANSPORTER 1... Lus10032154 18.3 0.8586
AT5G17240 SDG40 SET domain group 40 (.1) Lus10035757 72.7 0.8347
AT3G02750 Protein phosphatase 2C family ... Lus10021486 127.4 0.8166

Lus10008425 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.