Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G28060 157 / 5e-51 5'-AMP-activated protein kinase beta-2 subunit protein (.1) AT4G16360 113 / 5e-32 5'-AMP-activated protein kinase beta-2 subunit protein (.1.2.3) AT5G21170 100 / 5e-27 AKINBETA1 5'-AMP-activated protein kinase beta-2 subunit protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003355 [exp] 216 / 1e-74 AT2G28060 150 / 2e-48 5'-AMP-activated protein kinase beta-2 subunit protein (.1) Lus10038783 [exp] 105 / 2e-28 AT4G16360 395 / 1e-139 5'-AMP-activated protein kinase beta-2 subunit protein (.1.2.3) Lus10039076 [exp] 104 / 5e-28 AT4G16360 392 / 2e-138 5'-AMP-activated protein kinase beta-2 subunit protein (.1.2.3) Lus10037424 [exp] 95 / 7e-25 AT5G21170 305 / 2e-104 5'-AMP-activated protein kinase beta-2 subunit protein (.1.2) Lus10041287 [exp] 96 / 1e-24 AT5G21170 295 / 6e-100 5'-AMP-activated protein kinase beta-2 subunit protein (.1.2) Lus10012343 [exp] 83 / 1e-20 AT4G16360 220 / 1e-72 5'-AMP-activated protein kinase beta-2 subunit protein (.1.2.3) Lus10006390 [exp] 79 / 9e-19 AT4G16360 222 / 3e-72 5'-AMP-activated protein kinase beta-2 subunit protein (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G008700 [exp] 189 / 1e-63 AT2G28060 158 / 2e-51 5'-AMP-activated protein kinase beta-2 subunit protein (.1) Potri.004G213600 [exp] 184 / 8e-62 AT2G28060 156 / 8e-51 5'-AMP-activated protein kinase beta-2 subunit protein (.1) Potri.016G006400 [exp] 108 / 7e-30 AT4G16360 415 / 5e-148 5'-AMP-activated protein kinase beta-2 subunit protein (.1.2.3) Potri.006G005800 [exp] 107 / 1e-29 AT4G16360 408 / 3e-145 5'-AMP-activated protein kinase beta-2 subunit protein (.1.2.3) Potri.001G220800 [exp] 100 / 1e-26 AT5G21170 316 / 1e-108 5'-AMP-activated protein kinase beta-2 subunit protein (.1.2) Potri.009G021600 [exp] 96 / 3e-25 AT5G21170 319 / 1e-109 5'-AMP-activated protein kinase beta-2 subunit protein (.1.2) Potri.014G167400 [exp] 73 / 2e-16 AT4G16360 206 / 2e-65 5'-AMP-activated protein kinase beta-2 subunit protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04739 [flax] [poplar] AMPKBI 5'-AMP-activated protein kinase beta subunit, interaction domain
Representative CDS sequence Show only first row Show all	>Lus10008427 pacid=23163495 polypeptide=Lus10008427 locus=Lus10008427.g ID=Lus10008427.BGIv1.0 annot-version=v1.0 ATGAACATCCAACGTGTCGAAAATCATGAAGAACCAACCGTAGCGGGATTCGAAGTCCCTAACTCTCCTGATTCAAGCTACACAAATGCTTACCCTGGAA CAGAAGATGAGGCGCGGGACCCTCCTGCAGTTCCTCCACACCTGCAGCAGACTTTGCTCGGCTACCCAGCAAGTGCAGATACTTCGGAGTCAATCCCGCC TCCACAGGATGTTATTCTGAACCATCTCTATATCGAGAATCGGGAGCCACCACGGTCAGTGGTGGCACTCGGGTTCACTCATCGTTTCCGAGCAAAGTAT GTCACAGTTGTGCTATACAAACCTGTTCAGAGGAGGGGGAGTACCAGCGCATAG
AA sequence Show only first row Show all	>Lus10008427 pacid=23163495 polypeptide=Lus10008427 locus=Lus10008427.g ID=Lus10008427.BGIv1.0 annot-version=v1.0 MNIQRVENHEEPTVAGFEVPNSPDSSYTNAYPGTEDEARDPPAVPPHLQQTLLGYPASADTSESIPPPQDVILNHLYIENREPPRSVVALGFTHRFRAKY VTVVLYKPVQRRGSTSA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G28060			5'-AMP-activated protein kinas...		Lus10008427 [exp]	0	1
AT1G07570		APK1A	Protein kinase superfamily pro...		Lus10000954 [exp]	1.7	0.9096
AT3G18215			Protein of unknown function, D...		Lus10009640 [exp]	2.8	0.9017
AT5G11330			FAD/NAD(P)-binding oxidoreduct...		Lus10013121 [exp]	3.0	0.9042
AT5G14950		GMII, ATGMII	golgi alpha-mannosidase II (.1...		Lus10039456 [exp]	6.0	0.8946
AT1G75440		UBC16	ubiquitin-conjugating enzyme 1...		Lus10041791 [exp]	7.1	0.8625
AT3G60300			RWD domain-containing protein ...		Lus10009773 [exp]	10.6	0.8818
AT4G27120			unknown protein		Lus10011161 [exp]	10.9	0.9043
AT3G28050			nodulin MtN21 /EamA-like trans...		Lus10039428 [exp]	14.0	0.8825
AT4G04470		PMP22	Peroxisomal membrane 22 kDa (M...		Lus10020027 [exp]	15.0	0.8928
AT5G11330			FAD/NAD(P)-binding oxidoreduct...		Lus10013122 [exp]	15.5	0.8925

Compare expression of checked genes

Lus10008427 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.