Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G06570 78 / 3e-18 alpha/beta-Hydrolases superfamily protein (.1.2) AT3G63010 44 / 5e-06 ATGID1B, GID1B GA INSENSITIVE DWARF1B, alpha/beta-Hydrolases superfamily protein (.1) AT3G05120 44 / 6e-06 ATGID1A, GID1A GA INSENSITIVE DWARF1A, alpha/beta-Hydrolases superfamily protein (.1) AT5G27320 43 / 1e-05 ATGID1C, GID1C GA INSENSITIVE DWARF1C, alpha/beta-Hydrolases superfamily protein (.1) AT5G16080 37 / 0.0009 ATCXE17 carboxyesterase 17 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013376 [exp] 152 / 8e-47 AT5G06570 256 / 3e-84 alpha/beta-Hydrolases superfamily protein (.1.2) Lus10013377 [exp] 141 / 4e-40 AT3G44050 1290 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10008439 [exp] 130 / 6e-38 AT5G06570 281 / 8e-94 alpha/beta-Hydrolases superfamily protein (.1.2) Lus10036168 [exp] 105 / 3e-28 AT5G06570 321 / 2e-109 alpha/beta-Hydrolases superfamily protein (.1.2) Lus10008440 [exp] 84 / 3e-21 ND 62 / 8e-12 Lus10016204 [exp] 85 / 7e-21 AT5G06570 260 / 7e-86 alpha/beta-Hydrolases superfamily protein (.1.2) Lus10029341 [exp] 84 / 2e-20 AT5G06570 293 / 5e-98 alpha/beta-Hydrolases superfamily protein (.1.2) Lus10015988 [exp] 78 / 5e-18 AT5G06570 346 / 5e-119 alpha/beta-Hydrolases superfamily protein (.1.2) Lus10015989 [exp] 77 / 8e-18 AT5G06570 337 / 1e-115 alpha/beta-Hydrolases superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G155800 [exp] 95 / 2e-24 AT5G06570 310 / 4e-105 alpha/beta-Hydrolases superfamily protein (.1.2) Potri.006G198800 [exp] 87 / 1e-21 AT5G06570 373 / 1e-129 alpha/beta-Hydrolases superfamily protein (.1.2) Potri.016G065000 [exp] 85 / 7e-21 AT5G06570 376 / 7e-131 alpha/beta-Hydrolases superfamily protein (.1.2) Potri.004G101400 [exp] 51 / 2e-08 AT5G16080 357 / 6e-123 carboxyesterase 17 (.1) Potri.013G028700 [exp] 47 / 6e-07 AT5G27320 608 / 0.0 GA INSENSITIVE DWARF1C, alpha/beta-Hydrolases superfamily protein (.1) Potri.005G040600 [exp] 45 / 1e-06 AT5G27320 570 / 0.0 GA INSENSITIVE DWARF1C, alpha/beta-Hydrolases superfamily protein (.1) Potri.018G028300 [exp] 45 / 2e-06 AT1G68620 199 / 1e-61 alpha/beta-Hydrolases superfamily protein (.1) Potri.017G113700 [exp] 44 / 5e-06 AT5G16080 358 / 3e-123 carboxyesterase 17 (.1) Potri.010G127600 [exp] 44 / 8e-06 AT5G16080 346 / 2e-118 carboxyesterase 17 (.1) Potri.004G092500 [exp] 43 / 1e-05 AT5G23530 388 / 3e-135 carboxyesterase 18 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0028 [flax] [poplar] AB_hydrolase PF07859 [flax] [poplar] Abhydrolase_3 alpha/beta hydrolase fold
Representative CDS sequence Show only first row Show all	>Lus10008441 pacid=23163505 polypeptide=Lus10008441 locus=Lus10008441.g ID=Lus10008441.BGIv1.0 annot-version=v1.0 ATGTCGGAAACTCCTCCTCCCGCCGCTGAAAAGGATCTGCCGCTGAATTCTTCTAGCCTGTTCTTCAGGCACTCAGTTCCGGAGGGCGAAACATCCGATT ATCCAGCAGTGAACCCATGTCGACCGAAAAGCAAGGACCTTGCAACCGTAGAGCTTAACGCAATGCCAGTGGTTTCCGGCAGAAGGGATGTACTTGTAGA CCGTATCAGAGACTACGTCCACAAGCTGAAGCAGATGGGGAAGAAGATTCAGTATGCTGAGTTTGAAGCAGAGCATCATGCATTTTTCACCACTTCCCCG GATTCTGAAGCTGCAAACTCTCATAGATCTCATCAAGAAATTTGTCACTGA
AA sequence Show only first row Show all	>Lus10008441 pacid=23163505 polypeptide=Lus10008441 locus=Lus10008441.g ID=Lus10008441.BGIv1.0 annot-version=v1.0 MSETPPPAAEKDLPLNSSSLFFRHSVPEGETSDYPAVNPCRPKSKDLATVELNAMPVVSGRRDVLVDRIRDYVHKLKQMGKKIQYAEFEAEHHAFFTTSP DSEAANSHRSHQEICH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G06570			alpha/beta-Hydrolases superfam...		Lus10008441 [exp]	0	1
AT4G23310		CRK23	cysteine-rich RLK (RECEPTOR-li...		Lus10009583 [exp]	1.4	0.9961
AT4G31920	GARP	ARR10	response regulator 10 (.1)		Lus10025044 [exp]	2.8	0.9855
AT5G58980			Neutral/alkaline non-lysosomal...		Lus10021829 [exp]	3.0	0.9809
AT3G19000			2-oxoglutarate (2OG) and Fe(II...		Lus10042155 [exp]	3.5	0.9542
AT5G52170	HD	HDG7	homeodomain GLABROUS 7 (.1)		Lus10035095 [exp]	4.9	0.9682
AT1G71530			Protein kinase superfamily pro...		Lus10001470 [exp]	5.0	0.9716
					Lus10038267 [exp]	5.3	0.8910
AT1G68310		AE7	AS1/2 ENHANCER7, Protein of un...		Lus10031007 [exp]	5.7	0.9756
					Lus10033901 [exp]	6.7	0.9670
					Lus10002291 [exp]	6.9	0.9676

Compare expression of checked genes

Lus10008441 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.