Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G26740 71 / 1e-16 Ribosomal L32p protein family (.1) AT1G69485 58 / 3e-12 Ribosomal L32p protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G165100 [exp] 89 / 9e-24 AT1G26740 136 / 4e-42 Ribosomal L32p protein family (.1) Potri.008G090100 [exp] 84 / 6e-22 AT1G26740 133 / 8e-41 Ribosomal L32p protein family (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10008442 pacid=23163490 polypeptide=Lus10008442 locus=Lus10008442.g ID=Lus10008442.BGIv1.0 annot-version=v1.0 ATGTTGTCGAGGTTCGCGATCCTGAGAACCACAGTTGTCAATACCGAGTGGACTGCTCCAGGGTTCAGGCGTTGGGCACACAATGCCTCCGCCATGGCTC CACCGCTTAGTAATTGCATCCAACGAACACCCCTTCCCCCACCGTCGCTGTATCCTTGGTCTTCTCCAAATCCGGACACGGACGGCGAGTGGAGCAGCAA CCACATCGGCATCGATAAAGACAGCGACTTGGGAGGACTGGGGTTGCCGGGTGTCTCCGATGGTAGCGCTATCGAGCTAGCTCTTCCCAAAAGGAAGGTT ACTCCACACAAGAGAGGCATTAGAAATGGGCCAAAGGCTTTGAAACCAACTCCTGTAATCATCCGCTGCCGGTAA
AA sequence Show only first row Show all	>Lus10008442 pacid=23163490 polypeptide=Lus10008442 locus=Lus10008442.g ID=Lus10008442.BGIv1.0 annot-version=v1.0 MLSRFAILRTTVVNTEWTAPGFRRWAHNASAMAPPLSNCIQRTPLPPPSLYPWSSPNPDTDGEWSSNHIGIDKDSDLGGLGLPGVSDGSAIELALPKRKV TPHKRGIRNGPKALKPTPVIIRCR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G26740			Ribosomal L32p protein family ...		Lus10008442 [exp]	0	1
AT2G03530		ATUPS2, UPS2	ARABIDOPSIS THALIANA UREIDE PE...		Lus10036911 [exp]	1.7	0.9245
AT4G15000			Ribosomal L27e protein family ...		Lus10039017 [exp]	2.4	0.9135
AT2G20490		NOP10, EDA27	EMBRYO SAC DEVELOPMENT ARREST ...		Lus10024913 [exp]	3.5	0.8580
AT3G16080			Zinc-binding ribosomal protein...		Lus10011446 [exp]	4.2	0.9055
AT1G05205			unknown protein		Lus10027173 [exp]	7.5	0.8719
AT3G10610			Ribosomal S17 family protein (...		Lus10016985 [exp]	9.2	0.8848
AT1G20580			Small nuclear ribonucleoprotei...		Lus10013227 [exp]	10.5	0.8591
AT1G09590			Translation protein SH3-like f...		Lus10021079 [exp]	11.0	0.8588
AT2G47640			Small nuclear ribonucleoprotei...		Lus10007876 [exp]	13.4	0.8543
AT3G53730			Histone superfamily protein (....		Lus10023331 [exp]	19.9	0.8809

Compare expression of checked genes

Lus10008442 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.