Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G58100 74 / 5e-17 TCP TCP8 TCP domain protein 8, TCP family transcription factor (.1.2) AT1G35560 71 / 8e-16 TCP TCP23 TCP family transcription factor (.1) AT1G72010 63 / 4e-13 TCP TCP22 TCP family transcription factor (.1) AT1G69690 55 / 3e-10 TCP AtTCP15, TCP15 TEOSINTE BRANCHED1/CYCLOIDEA/PCF 15, TCP family transcription factor (.1) AT3G47620 55 / 3e-10 TCP AtTCP14, TCP14 "TEOSINTE BRANCHED, cycloidea and PCF \(TCP\) 14", TEOSINTE BRANCHED, cycloidea and PCF (TCP) 14 (.1) AT5G23280 50 / 8e-09 TCP TCP7 TCP family transcription factor (.1) AT3G27010 49 / 4e-08 TCP ATTCP20, PCF1, AT-TCP20 ARABIDOPSIS THALIANA TEOSINTE BRANCHED 1, CYCLOIDEA, PCF \(TCP\)-DOMAIN FAMILY PROTEIN 20, TEOSINTE BRANCHED 1, cycloidea, PCF (TCP)-domain family protein 20 (.1) AT2G45680 48 / 7e-08 TCP TCP9 TCP family transcription factor (.1) AT5G08330 46 / 3e-07 TCP AtTCP11, CHE, TCP21 TCP domain protein 11, TCP family transcription factor (.1) AT5G51910 45 / 8e-07 TCP TCP19 TCP family transcription factor (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037190 [exp] 72 / 5e-16 AT1G69690 172 / 9e-50 TEOSINTE BRANCHED1/CYCLOIDEA/PCF 15, TCP family transcription factor (.1) Lus10008621 [exp] 66 / 4e-14 AT3G47620 140 / 4e-38 "TEOSINTE BRANCHED, cycloidea and PCF \(TCP\) 14", TEOSINTE BRANCHED, cycloidea and PCF (TCP) 14 (.1) Lus10019949 [exp] 52 / 3e-09 AT1G58100 89 / 3e-19 TCP domain protein 8, TCP family transcription factor (.1.2) Lus10037046 [exp] 45 / 2e-07 AT3G27010 145 / 5e-44 ARABIDOPSIS THALIANA TEOSINTE BRANCHED 1, CYCLOIDEA, PCF \(TCP\)-DOMAIN FAMILY PROTEIN 20, TEOSINTE BRANCHED 1, cycloidea, PCF (TCP)-domain family protein 20 (.1) Lus10032022 [exp] 47 / 3e-07 AT3G27010 234 / 2e-75 ARABIDOPSIS THALIANA TEOSINTE BRANCHED 1, CYCLOIDEA, PCF \(TCP\)-DOMAIN FAMILY PROTEIN 20, TEOSINTE BRANCHED 1, cycloidea, PCF (TCP)-domain family protein 20 (.1) Lus10035193 [exp] 46 / 3e-07 AT3G27010 156 / 6e-47 ARABIDOPSIS THALIANA TEOSINTE BRANCHED 1, CYCLOIDEA, PCF \(TCP\)-DOMAIN FAMILY PROTEIN 20, TEOSINTE BRANCHED 1, cycloidea, PCF (TCP)-domain family protein 20 (.1) Lus10010177 [exp] 46 / 5e-07 AT5G23280 186 / 1e-57 TCP family transcription factor (.1) Lus10015760 [exp] 45 / 6e-07 AT3G27010 181 / 1e-55 ARABIDOPSIS THALIANA TEOSINTE BRANCHED 1, CYCLOIDEA, PCF \(TCP\)-DOMAIN FAMILY PROTEIN 20, TEOSINTE BRANCHED 1, cycloidea, PCF (TCP)-domain family protein 20 (.1) Lus10013814 [exp] 44 / 3e-06 AT3G47620 119 / 2e-32 "TEOSINTE BRANCHED, cycloidea and PCF \(TCP\) 14", TEOSINTE BRANCHED, cycloidea and PCF (TCP) 14 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G222100 [exp] 79 / 8e-19 AT1G58100 172 / 4e-48 TCP domain protein 8, TCP family transcription factor (.1.2) Potri.013G110700 [exp] 77 / 3e-18 AT1G35560 224 / 9e-70 TCP family transcription factor (.1) Potri.019G081800 [exp] 77 / 4e-18 AT1G72010 220 / 5e-68 TCP family transcription factor (.1) Potri.011G055500 [exp] 55 / 4e-10 AT3G47620 173 / 2e-49 "TEOSINTE BRANCHED, cycloidea and PCF \(TCP\) 14", TEOSINTE BRANCHED, cycloidea and PCF (TCP) 14 (.1) Potri.004G046300 [exp] 54 / 7e-10 AT3G47620 182 / 2e-52 "TEOSINTE BRANCHED, cycloidea and PCF \(TCP\) 14", TEOSINTE BRANCHED, cycloidea and PCF (TCP) 14 (.1) Potri.007G074028 [exp] 54 / 8e-10 AT5G23280 196 / 3e-62 TCP family transcription factor (.1) Potri.005G090300 [exp] 54 / 8e-10 AT5G23280 169 / 9e-52 TCP family transcription factor (.1) Potri.017G068748 [exp] 49 / 4e-08 AT3G27010 231 / 3e-74 ARABIDOPSIS THALIANA TEOSINTE BRANCHED 1, CYCLOIDEA, PCF \(TCP\)-DOMAIN FAMILY PROTEIN 20, TEOSINTE BRANCHED 1, cycloidea, PCF (TCP)-domain family protein 20 (.1) Potri.001G327100 [exp] 49 / 5e-08 AT3G27010 230 / 6e-74 ARABIDOPSIS THALIANA TEOSINTE BRANCHED 1, CYCLOIDEA, PCF \(TCP\)-DOMAIN FAMILY PROTEIN 20, TEOSINTE BRANCHED 1, cycloidea, PCF (TCP)-domain family protein 20 (.1) Potri.014G078500 [exp] 48 / 7e-08 AT2G45680 257 / 1e-83 TCP family transcription factor (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03634 [flax] [poplar] TCP TCP family transcription factor
Representative CDS sequence Show only first row Show all	>Lus10008444 pacid=23163517 polypeptide=Lus10008444 locus=Lus10008444.g ID=Lus10008444.BGIv1.0 annot-version=v1.0 ATGCCGGCGACTTGCGCGTCTAGGGAATTGGGGCATAAATTCGACGGCGAGACAATTGAGTGGCTTCTCCAACAAGCTGAGCCGACAATTATTGCGGCTA CTGGAACGGGAACGATTCCGGCCAATTTCTCGACTATGAATGTCTGGTTGAGGAGCAGTGGATCTACGCTCTCTGCTCCTGCTTCAAACATGGGGTATTA TCGGCGTCTTCTTCTCCAGCCCCACTTCAATCCACCATCGACGCTACTGCCGTCGGTTTCAGTTTAA
AA sequence Show only first row Show all	>Lus10008444 pacid=23163517 polypeptide=Lus10008444 locus=Lus10008444.g ID=Lus10008444.BGIv1.0 annot-version=v1.0 MPATCASRELGHKFDGETIEWLLQQAEPTIIAATGTGTIPANFSTMNVWLRSSGSTLSAPASNMGYYRRLLLQPHFNPPSTLLPSVSV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G58100	TCP	TCP8	TCP domain protein 8, TCP fami...		Lus10008444 [exp]	0	1
AT3G55140			Pectin lyase-like superfamily ...		Lus10003307 [exp]	1.7	0.8171
AT1G66730		AtLIG6	DNA LIGASE 6 (.1)		Lus10033580 [exp]	2.8	0.7995
AT1G68930			pentatricopeptide (PPR) repeat...		Lus10030908 [exp]	13.6	0.7740
AT1G69530		ATHEXPALPHA1.2,...	EXPANSIN 1, expansin A1 (.1.2....		Lus10026614 [exp]	14.0	0.7520
AT5G14370			CCT motif family protein (.1)		Lus10014886 [exp]	15.1	0.7874
AT4G29310			Protein of unknown function (D...		Lus10012933 [exp]	20.6	0.7597
AT3G52150			RNA-binding (RRM/RBD/RNP motif...		Lus10010262 [exp]	25.6	0.7864
AT3G09870			SAUR-like auxin-responsive pro...		Lus10023012 [exp]	26.8	0.7577
AT3G18550	TCP	AtBRC1, ATTCP18...	BRANCHED 1, TCP family transcr...		Lus10021713 [exp]	33.9	0.7270
AT5G24510			60S acidic ribosomal protein f...		Lus10034864 [exp]	41.9	0.7170

Compare expression of checked genes

Lus10008444 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.