Plant FIBer expression Database

Lus10008448 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G08480 222 / 7e-76 SDH6 succinate dehydrogenase 6, unknown protein
AT3G26840 39 / 0.0004 Esterase/lipase/thioesterase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013373
[exp]
295 / 8e-105 AT1G08480 222 / 9e-76 succinate dehydrogenase 6, unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G001100
[exp]
223 / 2e-76 AT1G08480 215 / 4e-73 succinate dehydrogenase 6, unknown protein
PFAM info
Representative CDS sequence
>Lus10008448 pacid=23163465 polypeptide=Lus10008448 locus=Lus10008448.g ID=Lus10008448.BGIv1.0 annot-version=v1.0
ATGGCAGATGCATCGAAATCGTTTCTGAGCAGGCACTGGGAAGAATACAAGAGCTTCTGGGCCGAGAGATTCTCGTTTCTAGACAACTACTCCAGATTCA
TCAATCGCGATAAGCCTCTCCCTTCCTGGTCCTCCGACGACGTCCAGGAGTTCATTGCCTCCGATCCCGTTCACGGCCCCGTTCTGAAAACAGCTAGGGA
AGCAGCATCGTTCGGTCTTACTGGAAGTCTTCTCGGAGCAGTATCGACTGCTGCTTTCGCTTGGAAATACTCAAAAAGCCCACATGGTGCTGGTCTTTCC
TTCATAGCCGGAGGTGCCTTCGGTTGGACATTTGGTCATGAAGTTGCAAACCATTGGTTCCAGCTATACAGGATGGACACCATGGCTGCACAGGTAAAGT
TCATGGAATGGTGGGAGGAGAAATCTGAAGCCCAGTCGTAA
AA sequence
>Lus10008448 pacid=23163465 polypeptide=Lus10008448 locus=Lus10008448.g ID=Lus10008448.BGIv1.0 annot-version=v1.0
MADASKSFLSRHWEEYKSFWAERFSFLDNYSRFINRDKPLPSWSSDDVQEFIASDPVHGPVLKTAREAASFGLTGSLLGAVSTAAFAWKYSKSPHGAGLS
FIAGGAFGWTFGHEVANHWFQLYRMDTMAAQVKFMEWWEEKSEAQS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G08480 SDH6 succinate dehydrogenase 6, unk... Lus10008448
[exp]
0 1
AT3G52300 ATPQ "ATP synthase D chain, mitocho... Lus10023337
[exp]
3.0 0.8776
AT1G11360 Adenine nucleotide alpha hydro... Lus10037867
[exp]
3.2 0.9048
AT5G40150 Peroxidase superfamily protein... Lus10014517
[exp]
3.5 0.8901
AT3G44150 unknown protein Lus10016181
[exp]
4.2 0.8914
AT2G02050 NADH-ubiquinone oxidoreductase... Lus10034424
[exp]
5.0 0.8485
AT1G64980 Nucleotide-diphospho-sugar tra... Lus10005005
[exp]
5.7 0.8611
AT4G21320 HSA32 HEAT-STRESS-ASSOCIATED 32, Ald... Lus10018387
[exp]
6.9 0.8994
AT1G53540 HSP20-like chaperones superfam... Lus10040830
[exp]
8.4 0.8894
AT2G26110 Protein of unknown function (D... Lus10024988
[exp]
8.7 0.8617
AT2G38360 PRA1.B4 prenylated RAB acceptor 1.B4 (... Lus10026404
[exp]
8.8 0.8694

Lus10008448 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.