Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G24140 57 / 9e-11 Matrixin family protein (.1) AT1G59970 56 / 2e-10 Matrixin family protein (.1) AT1G70170 53 / 2e-09 MMP matrix metalloproteinase (.1) AT4G16640 49 / 4e-08 Matrixin family protein (.1) AT2G45040 40 / 8e-05 Matrixin family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039464 [exp] 146 / 8e-45 AT1G24140 224 / 3e-71 Matrixin family protein (.1) Lus10005605 [exp] 137 / 3e-41 AT1G24140 223 / 9e-71 Matrixin family protein (.1) Lus10035221 [exp] 108 / 4e-30 AT1G24140 216 / 1e-67 Matrixin family protein (.1) Lus10032175 [exp] 66 / 5e-14 AT1G59970 224 / 3e-71 Matrixin family protein (.1) Lus10014512 [exp] 61 / 2e-12 AT1G59970 221 / 6e-70 Matrixin family protein (.1) Lus10010719 [exp] 61 / 4e-12 AT1G70170 305 / 3e-102 matrix metalloproteinase (.1) Lus10030662 [exp] 50 / 2e-08 AT1G59970 338 / 9e-115 Matrixin family protein (.1) Lus10004728 [exp] 41 / 3e-05 AT4G16640 350 / 2e-119 Matrixin family protein (.1) Lus10041294 [exp] 39 / 0.0003 AT1G59970 177 / 3e-53 Matrixin family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G104600 [exp] 74 / 4e-17 AT1G24140 393 / 5e-136 Matrixin family protein (.1) Potri.013G033200 [exp] 71 / 7e-16 AT1G24140 246 / 2e-79 Matrixin family protein (.1) Potri.008G027700 [exp] 70 / 2e-15 AT1G59970 219 / 5e-69 Matrixin family protein (.1) Potri.015G103900 [exp] 68 / 1e-14 AT1G24140 381 / 3e-131 Matrixin family protein (.1) Potri.008G027500 [exp] 67 / 1e-14 AT1G59970 219 / 2e-69 Matrixin family protein (.1) Potri.008G027975 [exp] 64 / 1e-13 AT1G59970 216 / 4e-68 Matrixin family protein (.1) Potri.013G100400 [exp] 55 / 5e-10 AT1G59970 247 / 4e-80 Matrixin family protein (.1) Potri.019G073400 [exp] 54 / 5e-10 AT1G70170 215 / 2e-67 matrix metalloproteinase (.1) Potri.019G073800 [exp] 53 / 2e-09 AT1G70170 223 / 1e-70 matrix metalloproteinase (.1) Potri.008G027900 [exp] 52 / 5e-09 AT1G59970 192 / 9e-59 Matrixin family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10008449 pacid=23163472 polypeptide=Lus10008449 locus=Lus10008449.g ID=Lus10008449.BGIv1.0 annot-version=v1.0 ATGACCCCACGTTGCGGTGTGGCTGACATTGTCAACGGTACAAACTGGATGCAACACAAGCCAACTGACGGACGCCTTCATACAGTGTCCCATTACGCCT TCTTTAGAGGAAGGCCTAAGTGGAGAGCCTCAAGGCTCGCTTATGGGTTCCACCCTGGAACTCAACCAGAAGCTATGGACGCGGTGTCAAGAGCTTACTT GACATGGTCCCAAAACTCGCACTTCAAGTTCGAGAGGACAAGTGGCGAGAACATCATGCCCGATATGATGATTGGGTTCCGCACCGGATAA
AA sequence Show only first row Show all	>Lus10008449 pacid=23163472 polypeptide=Lus10008449 locus=Lus10008449.g ID=Lus10008449.BGIv1.0 annot-version=v1.0 MTPRCGVADIVNGTNWMQHKPTDGRLHTVSHYAFFRGRPKWRASRLAYGFHPGTQPEAMDAVSRAYLTWSQNSHFKFERTSGENIMPDMMIGFRTG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G24140			Matrixin family protein (.1)		Lus10008449 [exp]	0	1
AT3G03550			RING/U-box superfamily protein...		Lus10009264 [exp]	3.9	0.7259
AT1G31770		ABCG14	ATP-binding cassette G14, ATP-...		Lus10035692 [exp]	6.5	0.7244
AT5G36930			Disease resistance protein (TI...		Lus10026845 [exp]	13.0	0.7592
AT4G24120		ATYSL1, YSL1	YELLOW STRIPE like 1 (.1)		Lus10033231 [exp]	13.3	0.7699
					Lus10032841 [exp]	21.0	0.7503
AT5G36930			Disease resistance protein (TI...		Lus10030498 [exp]	25.7	0.7296
AT3G46290		HERK1	hercules receptor kinase 1 (.1...		Lus10012647 [exp]	36.6	0.7193
AT4G33550			Bifunctional inhibitor/lipid-t...		Lus10027345 [exp]	38.5	0.7192
AT3G15270	SBP	SPL5	squamosa promoter binding prot...		Lus10005548 [exp]	40.4	0.7150
AT2G35190		NSPN11, ATNPSN1...	novel plant snare 11 (.1)		Lus10003004 [exp]	45.7	0.7100

Compare expression of checked genes

Lus10008449 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.