Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G22010 45 / 2e-06 ATRFC1 replication factor C 1, replication factor C1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013372 [exp] 97 / 2e-24 AT5G22010 1128 / 0.0 replication factor C 1, replication factor C1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G213900 [exp] 59 / 3e-11 AT5G22010 1117 / 0.0 replication factor C 1, replication factor C1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10008450 pacid=23163468 polypeptide=Lus10008450 locus=Lus10008450.g ID=Lus10008450.BGIv1.0 annot-version=v1.0 ATGAAAAAGGCCCCTAAGAAGCGTATAGCTGCAATGTTGGAACCTCCAAGTGAAGGCTTAGGGGAGGAAACTGTTGATCCAGTTGTAGAGAGTGAAGATG AGAACTCTTCTGACACACAGGATCCGGGGATAAAAGTTGAGATGGAATTGAAGAGTAGTACCCAAAATGCGAAGGGGAAGAAGGCACCTGGAGGTCGAGG TAGAGGTGGGGCGTCCAGTTCTGCAGAAAAGAAACCAGCAGGAAGGGGAAGAGGTGGCTCCAGTTCTGCTGGAGCTAAGAGAAAGATATATAAAAAAAAA GAGAGCAACTTCCTCTTGATCCTGGGTTGGTAA
AA sequence Show only first row Show all	>Lus10008450 pacid=23163468 polypeptide=Lus10008450 locus=Lus10008450.g ID=Lus10008450.BGIv1.0 annot-version=v1.0 MKKAPKKRIAAMLEPPSEGLGEETVDPVVESEDENSSDTQDPGIKVEMELKSSTQNAKGKKAPGGRGRGGASSSAEKKPAGRGRGGSSSAGAKRKIYKKK ESNFLLILGW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G22010		ATRFC1	replication factor C 1, replic...		Lus10008450 [exp]	0	1
AT5G57500			Galactosyltransferase family p...		Lus10006531 [exp]	16.0	0.6743
AT4G20090		EMB1025	embryo defective 1025, Pentatr...		Lus10038377 [exp]	53.2	0.6229
					Lus10030127 [exp]	79.2	0.6230
					Lus10011613 [exp]	89.8	0.5777
					Lus10026259 [exp]	96.1	0.6066
AT5G25120		CYP71B11	"ytochrome p450, family 71, su...		Lus10023709 [exp]	101.0	0.5964
AT4G01880			methyltransferases (.1)		Lus10038053 [exp]	117.4	0.5622
AT1G05420	OFP	ATOFP12, OFP12	ARABIDOPSIS THALIANA OVATE FAM...		Lus10006120 [exp]	124.1	0.5978
AT2G32190			unknown protein		Lus10031782 [exp]	145.8	0.5889

Compare expression of checked genes

Lus10008450 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.