Plant FIBer expression Database

Lus10008484 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G39680 89 / 2e-22 EMB2744 EMBRYO DEFECTIVE 2744, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G26630 70 / 8e-16 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G39530 59 / 7e-12 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G22070 59 / 9e-12 pentatricopeptide (PPR) repeat-containing protein (.1)
AT1G06150 58 / 2e-11 bHLH bHLH089, EMB1444 EMBRYO DEFECTIVE 1444, basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1), basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.2)
AT2G39620 58 / 2e-11 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT2G33680 57 / 2e-11 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G15130 57 / 3e-11 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G23330 57 / 3e-11 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G03380 57 / 3e-11 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001483
[exp]
142 / 2e-41 AT5G39680 691 / 0.0 EMBRYO DEFECTIVE 2744, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10019098
[exp]
66 / 3e-14 AT3G47840 697 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10012796
[exp]
66 / 4e-14 AT2G36980 516 / 1e-178 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10030908
[exp]
66 / 4e-14 AT1G68930 928 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Lus10039974
[exp]
64 / 1e-13 AT1G06150 612 / 0.0 EMBRYO DEFECTIVE 1444, basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1), basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.2)
Lus10033982
[exp]
63 / 3e-13 AT2G36980 554 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10017082
[exp]
63 / 4e-13 AT1G16480 507 / 3e-165 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Lus10008825
[exp]
62 / 6e-13 AT1G06150 614 / 0.0 EMBRYO DEFECTIVE 1444, basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1), basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.2)
Lus10013991
[exp]
62 / 6e-13 AT3G57430 632 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G084900
[exp]
95 / 2e-24 AT5G39680 782 / 0.0 EMBRYO DEFECTIVE 2744, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.018G067500
[exp]
67 / 9e-15 AT4G13650 590 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.002G258766
[exp]
63 / 3e-13 AT1G06150 705 / 0.0 EMBRYO DEFECTIVE 1444, basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1), basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.2)
Potri.016G051300
[exp]
63 / 4e-13 AT3G13770 908 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.010G136200
[exp]
62 / 4e-13 AT1G68930 997 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Potri.002G220600
[exp]
61 / 1e-12 AT3G26630 481 / 2e-167 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.002G030200
[exp]
61 / 1e-12 AT1G19720 985 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.003G164900
[exp]
61 / 1e-12 AT5G13230 950 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.010G020500
[exp]
61 / 2e-12 AT2G36980 725 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.004G047800
[exp]
60 / 4e-12 AT4G13650 654 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10008484 pacid=23177390 polypeptide=Lus10008484 locus=Lus10008484.g ID=Lus10008484.BGIv1.0 annot-version=v1.0
ATGGCTGCTTATTCCCAGAACGATTCTTTTGAGGAGGCGCTGAATTTGTTCACAGCAATGGAAATCAACGATGTTAGGCCGAACGAGTTTACATTGGCTG
TATCCATCAATGCTAGTGCAGGGTTGTCTACACTGAGGAATGGATGCCTGTTGCATGACCGTGCTATGAAGGCCGGTTTTATCGATCATGTGAGTGTCGG
AAATGCATTGATCGATATGTACGCCAAAAGATGA
AA sequence
>Lus10008484 pacid=23177390 polypeptide=Lus10008484 locus=Lus10008484.g ID=Lus10008484.BGIv1.0 annot-version=v1.0
MAAYSQNDSFEEALNLFTAMEINDVRPNEFTLAVSINASAGLSTLRNGCLLHDRAMKAGFIDHVSVGNALIDMYAKR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Download tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G39680 EMB2744 EMBRYO DEFECTIVE 2744, Pentatr... Lus10008484
[exp]
0 1

Lus10008484 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.