Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G22000 158 / 3e-51 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001488 [exp] 225 / 1e-77 AT4G22000 166 / 5e-54 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G015800 [exp] 196 / 3e-66 AT4G22000 151 / 3e-48 unknown protein Potri.015G012700 [exp] 196 / 6e-66 AT4G22000 147 / 6e-47 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10008487 pacid=23177407 polypeptide=Lus10008487 locus=Lus10008487.g ID=Lus10008487.BGIv1.0 annot-version=v1.0 ATGGCCGGTAAATTAGCAAGGAATTTGACGCAGGCTGTTGCAGAGTATCAGTATCCATGGAAGGAGAAGTTGGCGAAGCACAAAGACGAGCTATCCAAGG GCGTGTGGGGCTATTGGAACTTAGGTGCATGGACGCCTCTGCACATCAGCGCCCGTCGAAGAGCTAAACTGCGCAGGGAAGTTCTTCTTGCTGGGCAAGA CTGGCCATACGATCCGGAGAGGAAAGAAATGAAGACGAAAATGAAAGGACACAAATGCGACAGGATAGCTGCGGAGAAACGAGCAAACACTGTCAAGCTG ATGGAGAAAATGCCTGATATGTTGCTGGCATACAAGAAGAGAAGATGGGAGAAGAAGATGAAGGAAGAGGACAAGACTAAGTAG
AA sequence Show only first row Show all	>Lus10008487 pacid=23177407 polypeptide=Lus10008487 locus=Lus10008487.g ID=Lus10008487.BGIv1.0 annot-version=v1.0 MAGKLARNLTQAVAEYQYPWKEKLAKHKDELSKGVWGYWNLGAWTPLHISARRRAKLRREVLLAGQDWPYDPERKEMKTKMKGHKCDRIAAEKRANTVKL MEKMPDMLLAYKKRRWEKKMKEEDKTK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G22000			unknown protein		Lus10008487 [exp]	0	1
AT1G43860			sequence-specific DNA binding ...		Lus10029749 [exp]	1.4	0.9346
AT5G44200		ATCBP20, CBP20	CAP-binding protein 20 (.1.2)		Lus10017682 [exp]	2.0	0.9345
AT5G53070			Ribosomal protein L9/RNase H1 ...		Lus10022383 [exp]	2.0	0.9294
AT4G24940		ATSAE1A, AT-SAE...	SUMO-activating enzyme 1A (.1)		Lus10028846 [exp]	2.4	0.9307
AT3G55620		eIF6A, EMB1624	embryo defective 1624, eukaryo...		Lus10037938 [exp]	3.5	0.9273
AT3G46560		TIM9, EMB2474	embryo defective 2474, Tim10/D...		Lus10038695 [exp]	5.0	0.9287
AT3G10530			Transducin/WD40 repeat-like su...		Lus10035742 [exp]	5.5	0.9142
AT5G44200		ATCBP20, CBP20	CAP-binding protein 20 (.1.2)		Lus10033636 [exp]	5.8	0.8999
AT2G16860			GCIP-interacting family protei...		Lus10027464 [exp]	6.5	0.9180
AT5G15220			Ribosomal protein L27 family p...		Lus10007170 [exp]	6.7	0.9161

Compare expression of checked genes

Lus10008487 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.