Lus10008489 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G01750 181 / 1e-59 ADF11 actin depolymerizing factor 11 (.1)
AT4G00680 181 / 2e-59 ADF8 actin depolymerizing factor 8 (.1)
AT5G59890 177 / 4e-58 ADF4, ATADF4 actin depolymerizing factor 4 (.1.2)
AT3G46010 175 / 2e-57 ATADF1, ADF1 actin depolymerizing factor 1 (.1.2)
AT4G25590 174 / 8e-57 ADF7 actin depolymerizing factor 7 (.1)
AT4G34970 172 / 2e-56 ADF9 actin depolymerizing factor 9 (.1)
AT5G52360 172 / 2e-56 ADF10 actin depolymerizing factor 10 (.1)
AT2G16700 171 / 1e-55 ADF5, ATADF5 actin depolymerizing factor 5 (.1.2)
AT5G59880 169 / 4e-55 ADF3 actin depolymerizing factor 3 (.1.2)
AT3G46000 166 / 8e-54 ADF2 actin depolymerizing factor 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024418 181 / 9e-60 AT5G59890 249 / 6e-87 actin depolymerizing factor 4 (.1.2)
Lus10024417 178 / 2e-58 AT3G46010 250 / 3e-87 actin depolymerizing factor 1 (.1.2)
Lus10025319 178 / 2e-58 AT3G46010 250 / 3e-87 actin depolymerizing factor 1 (.1.2)
Lus10022933 176 / 1e-57 AT2G31200 254 / 9e-89 actin depolymerizing factor 6 (.1)
Lus10014977 174 / 6e-57 AT4G25590 233 / 1e-80 actin depolymerizing factor 7 (.1)
Lus10038859 173 / 8e-57 AT4G25590 232 / 2e-80 actin depolymerizing factor 7 (.1)
Lus10024885 173 / 1e-56 AT2G31200 230 / 3e-79 actin depolymerizing factor 6 (.1)
Lus10039229 170 / 2e-55 AT5G52360 231 / 6e-80 actin depolymerizing factor 10 (.1)
Lus10027474 170 / 3e-55 AT5G52360 244 / 6e-85 actin depolymerizing factor 10 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G106200 199 / 6e-67 AT4G00680 234 / 6e-81 actin depolymerizing factor 8 (.1)
Potri.003G125500 194 / 5e-65 AT4G00680 234 / 1e-80 actin depolymerizing factor 8 (.1)
Potri.001G236700 186 / 7e-62 AT5G59890 256 / 2e-89 actin depolymerizing factor 4 (.1.2)
Potri.001G236400 183 / 1e-60 AT5G59890 246 / 1e-85 actin depolymerizing factor 4 (.1.2)
Potri.009G028200 182 / 3e-60 AT5G59890 258 / 4e-90 actin depolymerizing factor 4 (.1.2)
Potri.009G028100 182 / 5e-60 AT5G59890 256 / 1e-89 actin depolymerizing factor 4 (.1.2)
Potri.008G052100 181 / 1e-59 AT5G59890 249 / 1e-86 actin depolymerizing factor 4 (.1.2)
Potri.010G208500 172 / 2e-56 AT5G59890 255 / 4e-89 actin depolymerizing factor 4 (.1.2)
Potri.009G133100 172 / 3e-56 AT2G16700 257 / 7e-90 actin depolymerizing factor 5 (.1.2)
Potri.004G173800 171 / 1e-55 AT2G16700 255 / 4e-89 actin depolymerizing factor 5 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0092 ADF PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Representative CDS sequence
>Lus10008489 pacid=23177398 polypeptide=Lus10008489 locus=Lus10008489.g ID=Lus10008489.BGIv1.0 annot-version=v1.0
ATGTCGGGGAATGCCTCATCTGGTATGGCAGGGAGCGAGGAATGCAAAGAGAGATTCTTGGAGCTCAAGTCCAAGAGGATCCATCGATTCATCGTGTTCA
AGATCGAGGAGAAGAAGCAGAAGGTAACAGTGGAGAAGCTAGGCGAGCCTTGCCAAAGCTACAACGATTTCACAGCCAGCTTTCCTGAGAACGAGTGCAG
ATATGGCATCTTCGATTTCGATTTCACCACTCCCGACAACCTCAACAAGATCAAAATCTTCTTCATTTCCTGGTCTCCGGATTCGTCAAAGGTGAGGAAC
AAGATGCTGTATGCAAGTTCGAAAGACGGGCTCAGAAGGATCCTTGATGGAGTTCAAATTGAGGTCCAAGCTACTGAGCCATGTGAGATGAGCTTGGAGG
TTGTTCAAGAAAGAGCCCGTTGGTTGAATCATTGA
AA sequence
>Lus10008489 pacid=23177398 polypeptide=Lus10008489 locus=Lus10008489.g ID=Lus10008489.BGIv1.0 annot-version=v1.0
MSGNASSGMAGSEECKERFLELKSKRIHRFIVFKIEEKKQKVTVEKLGEPCQSYNDFTASFPENECRYGIFDFDFTTPDNLNKIKIFFISWSPDSSKVRN
KMLYASSKDGLRRILDGVQIEVQATEPCEMSLEVVQERARWLNH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G01750 ADF11 actin depolymerizing factor 11... Lus10008489 0 1
AT3G18215 Protein of unknown function, D... Lus10009640 3.0 0.9054
AT5G11330 FAD/NAD(P)-binding oxidoreduct... Lus10013122 3.5 0.9113
AT5G26610 D111/G-patch domain-containing... Lus10031446 3.7 0.9236
AT5G41470 Nuclear transport factor 2 (NT... Lus10024664 4.7 0.9029
AT5G36930 Disease resistance protein (TI... Lus10020534 5.3 0.9008
AT2G32760 unknown protein Lus10037826 7.5 0.8977
AT3G24490 Trihelix Alcohol dehydrogenase transcri... Lus10035893 8.8 0.9015
AT5G36930 Disease resistance protein (TI... Lus10018972 10.0 0.8936
AT4G27120 unknown protein Lus10011161 10.7 0.9109
AT1G54730 Major facilitator superfamily ... Lus10029966 13.0 0.9084

Lus10008489 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.