Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G16515 39 / 4e-05 RGF6 root meristem growth factor 6, unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028932 [exp] 44 / 1e-06 ND 44 / 1e-06 Lus10004351 [exp] 44 / 1e-06 ND 45 / 8e-07
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G122600 [exp] 40 / 4e-05 AT4G16515 45 / 9e-07 root meristem growth factor 6, unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10008506 pacid=23177361 polypeptide=Lus10008506 locus=Lus10008506.g ID=Lus10008506.BGIv1.0 annot-version=v1.0 ATGGTCGTCGTGGCCTCCCTCTCCTTGCATGCATGCAACGCTCGGCATCTCGTGACCAGTCGTCCTGCCCACGTCGTCGTCGGAGCTGATGAACGTTCGT CGCCGGAGTCTGCTTCCGAGGCCGAAAGCACAAAGATGAGAGGAAGAGAGCTGATGCTGGGAAACCACGGGGCAGAAGCTGATGTTAGGGAGACAAAGGA TGCAGAAGAAGAAGCAGAGGAGAGTGGAGGAGCAGTAGTTGTGATGGACTATGCTCAGCCTCATCGAAAGCCACCAATCCACAATGAGAAACACTAA
AA sequence Show only first row Show all	>Lus10008506 pacid=23177361 polypeptide=Lus10008506 locus=Lus10008506.g ID=Lus10008506.BGIv1.0 annot-version=v1.0 MVVVASLSLHACNARHLVTSRPAHVVVGADERSSPESASEAESTKMRGRELMLGNHGAEADVRETKDAEEEAEESGGAVVVMDYAQPHRKPPIHNEKH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G16515		RGF6	root meristem growth factor 6,...		Lus10008506 [exp]	0	1
AT4G34770			SAUR-like auxin-responsive pro...		Lus10012185 [exp]	1.0	0.9948
					Lus10019223 [exp]	1.4	0.9944
					Lus10025807 [exp]	1.7	0.9937
AT3G09790		UBQ8	ubiquitin 8 (.1)		Lus10022258 [exp]	3.5	0.9890
AT2G20760			Clathrin light chain protein (...		Lus10018582 [exp]	10.4	0.9818
AT5G15350		AtENODL17	early nodulin-like protein 17 ...		Lus10026064 [exp]	11.3	0.9781
					Lus10031379 [exp]	13.6	0.9534
AT1G24420			HXXXD-type acyl-transferase fa...		Lus10038687 [exp]	15.5	0.9174
AT4G35690			Arabidopsis protein of unknown...		Lus10041835 [exp]	17.4	0.9679
AT5G07010		ATST2A	ARABIDOPSIS THALIANA SULFOTRAN...		Lus10008673 [exp]	17.7	0.9653

Compare expression of checked genes

Lus10008506 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.