Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G16520 216 / 3e-74 ATG8F autophagy 8f, Ubiquitin-like superfamily protein (.1.2) AT3G60640 211 / 3e-72 ATG8G AUTOPHAGY 8G, Ubiquitin-like superfamily protein (.1) AT2G45170 206 / 4e-70 ATATG8E AUTOPHAGY 8E (.1.2) AT1G62040 202 / 1e-68 ATG8C autophagy 8c, Ubiquitin-like superfamily protein (.1.2) AT2G05630 200 / 5e-68 ATG8D Ubiquitin-like superfamily protein (.1.2) AT4G21980 191 / 3e-64 ATG8A, APG8A AUTOPHAGY-RELATED 8A, AUTOPHAGY 8A, Ubiquitin-like superfamily protein (.1.2) AT4G04620 184 / 2e-61 ATG8B autophagy 8b, Ubiquitin-like superfamily protein (.1.2) AT3G15580 131 / 8e-41 APG8H, ATG8I AUTOPHAGY 8I, AUTOPHAGY 8H, Ubiquitin-like superfamily protein (.1) AT3G06420 124 / 7e-38 ATG8H autophagy 8h, Ubiquitin-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000733 [exp] 245 / 2e-85 AT4G16520 217 / 1e-74 autophagy 8f, Ubiquitin-like superfamily protein (.1.2) Lus10028933 [exp] 224 / 3e-77 AT4G16520 215 / 6e-74 autophagy 8f, Ubiquitin-like superfamily protein (.1.2) Lus10004352 [exp] 209 / 7e-71 AT2G45170 203 / 1e-68 AUTOPHAGY 8E (.1.2) Lus10015563 [exp] 205 / 1e-69 AT1G62040 230 / 1e-79 autophagy 8c, Ubiquitin-like superfamily protein (.1.2) Lus10027186 [exp] 198 / 4e-67 AT2G05630 222 / 1e-76 Ubiquitin-like superfamily protein (.1.2) Lus10039656 [exp] 181 / 3e-59 AT2G05630 203 / 6e-68 Ubiquitin-like superfamily protein (.1.2) Lus10038046 [exp] 132 / 8e-41 AT3G15580 199 / 1e-67 AUTOPHAGY 8I, AUTOPHAGY 8H, Ubiquitin-like superfamily protein (.1) Lus10009987 [exp] 122 / 4e-33 AT3G62240 625 / 0.0 RING/U-box superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G144600 [exp] 223 / 6e-77 AT3G60640 192 / 8e-65 AUTOPHAGY 8G, Ubiquitin-like superfamily protein (.1) Potri.008G136040 [exp] 223 / 8e-77 AT4G16520 197 / 1e-66 autophagy 8f, Ubiquitin-like superfamily protein (.1.2) Potri.003G110901 [exp] 223 / 8e-77 AT4G16520 197 / 1e-66 autophagy 8f, Ubiquitin-like superfamily protein (.1.2) Potri.001G122700 [exp] 220 / 9e-76 AT4G16520 191 / 2e-64 autophagy 8f, Ubiquitin-like superfamily protein (.1.2) Potri.014G060300 [exp] 214 / 2e-73 AT4G16520 214 / 1e-73 autophagy 8f, Ubiquitin-like superfamily protein (.1.2) Potri.002G228800 [exp] 202 / 8e-69 AT2G05630 224 / 1e-77 Ubiquitin-like superfamily protein (.1.2) Potri.014G153800 [exp] 202 / 1e-68 AT2G05630 202 / 6e-69 Ubiquitin-like superfamily protein (.1.2) Potri.011G004300 [exp] 194 / 2e-65 AT4G21980 219 / 1e-74 AUTOPHAGY-RELATED 8A, AUTOPHAGY 8A, Ubiquitin-like superfamily protein (.1.2) Potri.004G013700 [exp] 192 / 6e-65 AT1G62040 216 / 3e-74 autophagy 8c, Ubiquitin-like superfamily protein (.1.2) Potri.008G099400 [exp] 132 / 3e-41 AT3G15580 187 / 7e-63 AUTOPHAGY 8I, AUTOPHAGY 8H, Ubiquitin-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [flax] [poplar] Ubiquitin PF02991 [flax] [poplar] Atg8 Autophagy protein Atg8 ubiquitin like
Representative CDS sequence Show only first row Show all	>Lus10008507 pacid=23177382 polypeptide=Lus10008507 locus=Lus10008507.g ID=Lus10008507.BGIv1.0 annot-version=v1.0 ATGGCTAAGAGTTCTTTCAAGCAAGAGCATGACTATGAGAAGAGAAAAGCTGAGGCTGACAGGATAAGGGAGAAATATTCTGATAGGATTCCGGTCATCG TGGAGAAGGCAGAGAGAAGTGAAATACCAAACATAGACAAGAAAAAGTACCTAGTCCCAGCAGACTTGACAGTGGGGCAGTTTGTTTATGTAATCCGGAA AAGGATCAAGTTGAGTGCTGAAAAGGCCATCTTCATATTTGTAGACAACGTCCTGCCACCAACCGGTGCTATAATGTCTGCAATATACGAAGAGAAGAAG GACGAGGATGGGTTTCTGTATGTTACTTACAGCGGCGAGAACACCTTCGGGGACGAAGAGATTCAGCTCTAG
AA sequence Show only first row Show all	>Lus10008507 pacid=23177382 polypeptide=Lus10008507 locus=Lus10008507.g ID=Lus10008507.BGIv1.0 annot-version=v1.0 MAKSSFKQEHDYEKRKAEADRIREKYSDRIPVIVEKAERSEIPNIDKKKYLVPADLTVGQFVYVIRKRIKLSAEKAIFIFVDNVLPPTGAIMSAIYEEKK DEDGFLYVTYSGENTFGDEEIQL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G16520		ATG8F	autophagy 8f, Ubiquitin-like s...		Lus10008507 [exp]	0	1
AT1G04970			lipid-binding serum glycoprote...		Lus10014625 [exp]	4.8	0.9517
AT2G02760		ATUBC2	ubiquitin-conjugating enzyme 2...		Lus10013263 [exp]	8.5	0.9347
AT2G26070		RTE1	REVERSION-TO-ETHYLENE SENSITIV...		Lus10030001 [exp]	8.5	0.9329
AT5G20090			Uncharacterised protein family...		Lus10038250 [exp]	9.5	0.9343
AT5G03455		ACR2, ARATH;CDC...	ARSENATE REDUCTASE 2, Rhodanes...		Lus10021515 [exp]	10.6	0.9307
AT4G32180		ATPANK2	pantothenate kinase 2 (.1.2.3)		Lus10013019 [exp]	11.4	0.9399
AT1G05410			Protein of unknown function (D...		Lus10041201 [exp]	13.1	0.9304
AT2G44420			protein N-terminal asparagine ...		Lus10020880 [exp]	14.6	0.9362
AT5G48340			unknown protein		Lus10036410 [exp]	14.8	0.9180
AT5G27450		MVK, MK	mevalonate kinase (.1.2.3)		Lus10015168 [exp]	15.2	0.9292

Compare expression of checked genes

Lus10008507 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.