Lus10008514 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004715 0 / 1 AT4G16570 741 / 0.0 ARABIDOPSIS THALIANA PROTEIN ARGININE METHYLTRANSFERASE 7, protein arginine methyltransferase 7 (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10008514 pacid=23177386 polypeptide=Lus10008514 locus=Lus10008514.g ID=Lus10008514.BGIv1.0 annot-version=v1.0
ATGAGAACAACGCCAGCCACCTTGATGTACAAGGAGTTGGTCATTGTCGATCTCGATTACGCAGGTCAGGTTCATGGAGCCTGGAATCTGCCATGGATTC
GTGCTGTGGCTGGACTGGGTTATGGATGCAAGCGAATCGGTTGTGATATCAACCAGACCGGAGATGCTGGAAATAAGGCGTCAAGCTCCTGTCGCAACCC
ATCCCGGTTGGAGCTCAGGGCCGGAACTCTGGTGGATTATGTTCATCTGTAA
AA sequence
>Lus10008514 pacid=23177386 polypeptide=Lus10008514 locus=Lus10008514.g ID=Lus10008514.BGIv1.0 annot-version=v1.0
MRTTPATLMYKELVIVDLDYAGQVHGAWNLPWIRAVAGLGYGCKRIGCDINQTGDAGNKASSSCRNPSRLELRAGTLVDYVHL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10008514 0 1
Lus10012394 5.0 0.8326
Lus10010102 5.1 0.8286
AT1G75660 AtXRN3, XRN3 5'-3' exoribonuclease 3 (.1) Lus10005213 9.3 0.7811
AT4G01580 B3 AP2/B3-like transcriptional fa... Lus10003313 10.7 0.7380
AT5G50600 ATHSD1 hydroxysteroid dehydrogenase 1... Lus10031448 12.0 0.7648
AT1G16445 S-adenosyl-L-methionine-depend... Lus10031751 13.1 0.7032
AT1G02205 CER1 ECERIFERUM 1, Fatty acid hydro... Lus10011472 16.1 0.7411
AT5G33340 CDR1 CONSTITUTIVE DISEASE RESISTANC... Lus10003281 16.1 0.7264
AT1G21880 LYM1 lysm domain GPI-anchored prote... Lus10006200 17.2 0.7264
AT1G47960 ATC/VIF1, C/VIF... cell wall / vacuolar inhibitor... Lus10023215 18.2 0.7264

Lus10008514 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.