Lus10008518 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G16600 608 / 0 Nucleotide-diphospho-sugar transferases superfamily protein (.1)
AT2G35710 606 / 0 Nucleotide-diphospho-sugar transferases superfamily protein (.1.2.3)
AT5G18480 100 / 3e-22 PGSIP6 plant glycogenin-like starch initiation protein 6 (.1)
AT1G08990 77 / 1e-14 PGSIP5 plant glycogenin-like starch initiation protein 5 (.1)
AT3G18660 67 / 1e-11 PGSIP1, GUX1 glucuronic acid substitution of xylan 1, plant glycogenin-like starch initiation protein 1 (.1.2.3)
AT1G54940 66 / 3e-11 PGSIP4 plant glycogenin-like starch initiation protein 4 (.1)
AT1G77130 64 / 1e-10 PGSIP2, GUX3 glucuronic acid substitution of xylan 3, plant glycogenin-like starch initiation protein 2 (.1)
AT4G33330 64 / 2e-10 PGSIP3, GUX2 glucuronic acid substitution of xylan 2, plant glycogenin-like starch initiation protein 3 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004717 852 / 0 AT4G16600 673 / 0.0 Nucleotide-diphospho-sugar transferases superfamily protein (.1)
Lus10027949 93 / 5e-20 AT5G18480 635 / 0.0 plant glycogenin-like starch initiation protein 6 (.1)
Lus10000817 77 / 1e-15 AT5G18480 329 / 2e-111 plant glycogenin-like starch initiation protein 6 (.1)
Lus10028623 73 / 3e-13 AT1G77130 830 / 0.0 glucuronic acid substitution of xylan 3, plant glycogenin-like starch initiation protein 2 (.1)
Lus10033485 71 / 8e-13 AT3G18660 677 / 0.0 glucuronic acid substitution of xylan 1, plant glycogenin-like starch initiation protein 1 (.1.2.3)
Lus10018922 71 / 8e-13 AT1G77130 847 / 0.0 glucuronic acid substitution of xylan 3, plant glycogenin-like starch initiation protein 2 (.1)
Lus10020890 71 / 1e-12 AT3G18660 828 / 0.0 glucuronic acid substitution of xylan 1, plant glycogenin-like starch initiation protein 1 (.1.2.3)
Lus10021731 70 / 2e-12 AT4G33330 803 / 0.0 glucuronic acid substitution of xylan 2, plant glycogenin-like starch initiation protein 3 (.1.2)
Lus10042658 69 / 5e-12 AT4G33330 801 / 0.0 glucuronic acid substitution of xylan 2, plant glycogenin-like starch initiation protein 3 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G076800 632 / 0 AT4G16600 633 / 0.0 Nucleotide-diphospho-sugar transferases superfamily protein (.1)
Potri.001G158000 630 / 0 AT4G16600 678 / 0.0 Nucleotide-diphospho-sugar transferases superfamily protein (.1)
Potri.013G049100 87 / 6e-18 AT5G18480 661 / 0.0 plant glycogenin-like starch initiation protein 6 (.1)
Potri.005G187900 74 / 9e-14 AT1G77130 803 / 0.0 glucuronic acid substitution of xylan 3, plant glycogenin-like starch initiation protein 2 (.1)
Potri.005G033500 72 / 5e-13 AT1G08990 555 / 0.0 plant glycogenin-like starch initiation protein 5 (.1)
Potri.007G107200 70 / 1e-12 AT3G18660 884 / 0.0 glucuronic acid substitution of xylan 1, plant glycogenin-like starch initiation protein 1 (.1.2.3)
Potri.014G029900 67 / 8e-12 AT4G33330 791 / 0.0 glucuronic acid substitution of xylan 2, plant glycogenin-like starch initiation protein 3 (.1.2)
Potri.005G061600 67 / 1e-11 AT3G18660 863 / 0.0 glucuronic acid substitution of xylan 1, plant glycogenin-like starch initiation protein 1 (.1.2.3)
Potri.013G022900 67 / 2e-11 AT1G08990 561 / 0.0 plant glycogenin-like starch initiation protein 5 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0110 GT-A PF01501 Glyco_transf_8 Glycosyl transferase family 8
Representative CDS sequence
>Lus10008518 pacid=23177396 polypeptide=Lus10008518 locus=Lus10008518.g ID=Lus10008518.BGIv1.0 annot-version=v1.0
ATGGCGAGCTGTAATGGGTTGCTGCTGTTGTTCTTCTTAGCTCTTGCCGTGTTAGGAGGATCCGAAACGGCGGCGTTCGGGCCTGAGAAGGGAGAGAAGA
AGATGACGATGACTCATCAGTTGTGGCCCAAGCATAGGAATGCTTACGCGACGATGATGTACATGGGTACTCCAAGGGACTACGAGTTCTACGTTGCTAC
TCGCGTCCTGCTCAGATCTTTGCGCAGTCTCTCTGTAAATGCTGATCTCGTCGTCATTGCTTCGCTCGATGTTCCTCCTCGATGGGTCCAAGCCATGGAA
AAGGAAGATGGGGCGAGAGTGGTGAGTGTGGAAAATGTGAACAATCCGTACAAGGACCAGAGCAACTTCGACCATAGATTCAAGCTTACACTGAACAAGC
TCTACGCTTGGAGCTTGGTGGACTACGAGCGGGTGGTCATGTTGGATGCTGATAATCTCTTCCTTCGCAACACCGACGAGCTTTTCCAGTGTGGGCAGTT
CTGTGCTGCGTTCATCAACCCCTGCATTTTCCATACTGGTCTCTTTGTATTGCAGCCGTCTAACGAAGTGTTCAAAGACATGCTTCATCAACTGGAAGTG
GGGAAAGACAACCCGGATGGTGCAGACCAAGGTTTCATCGGTGGATACTTCCCTGACTTGCTTGACAAGCCACTGTTCCACCCTCCTGCCAATGGCTCTG
TCGTTGCGGGTGGGAATCCAGACCTTAGACTCCGATGGAACGTCCCTTGTGGCCCTAATAGTGTCATAACTTTCCCCGGTGCGTCGTGGTTGAAGCCATG
GTACTGGTGGTCTTGGCCCGTTCTTCCTCTGGGCATCGACTGGCACGAGAAACGTCGTCAGCATCTTGGATATGGGGCAGAGATGCCAATGGTGGTGATC
CAATCAATACTCTACCTAGGAATCATAGCCGTGACTCGTCTAGCCCGACCAAACCTAACCAAGCTATGCTACCGAGGAAGCAGCGACAAGAACATTATCT
CCTCACTCCAATCCGGCCTAAAGGTGCTATCTTTATGGGCGATACTTGCAGCCTACGTAACCCCATTCTTCCTAATCCCTTGCACCCTCCACCCTCTACT
TGGCTGGTCACTCTACCTCCTCGGCACATTCGCACTCTGCTCGGTCGCCATCAACGCGTTCATGCTCCCAACGATCCACGTCCTGACACCATGGATCGGG
ATTTTCGGAGTTCTGCTAGTGATGGCGTGTCCTTGGTACACCAATGGAGTTGTGAGAGCACTGTCTGTATTCGTCTACGCCTTCTGCGCTGCTCCAGTGC
TCTGGATTTCTTCCACCAAAGTTGTTGCTAGCCTTCAGGTATCGCTCGAACGGGAAGCCTTCTTCCCCAAGCTCGGAGAATACTCTTCCCCTTCTTCTTC
GTCTTCTTCTTCCTCGCCACGCTTCGGGTTGAACAAGCTATGCTAA
AA sequence
>Lus10008518 pacid=23177396 polypeptide=Lus10008518 locus=Lus10008518.g ID=Lus10008518.BGIv1.0 annot-version=v1.0
MASCNGLLLLFFLALAVLGGSETAAFGPEKGEKKMTMTHQLWPKHRNAYATMMYMGTPRDYEFYVATRVLLRSLRSLSVNADLVVIASLDVPPRWVQAME
KEDGARVVSVENVNNPYKDQSNFDHRFKLTLNKLYAWSLVDYERVVMLDADNLFLRNTDELFQCGQFCAAFINPCIFHTGLFVLQPSNEVFKDMLHQLEV
GKDNPDGADQGFIGGYFPDLLDKPLFHPPANGSVVAGGNPDLRLRWNVPCGPNSVITFPGASWLKPWYWWSWPVLPLGIDWHEKRRQHLGYGAEMPMVVI
QSILYLGIIAVTRLARPNLTKLCYRGSSDKNIISSLQSGLKVLSLWAILAAYVTPFFLIPCTLHPLLGWSLYLLGTFALCSVAINAFMLPTIHVLTPWIG
IFGVLLVMACPWYTNGVVRALSVFVYAFCAAPVLWISSTKVVASLQVSLEREAFFPKLGEYSSPSSSSSSSSPRFGLNKLC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G35710 Nucleotide-diphospho-sugar tra... Lus10008518 0 1
AT1G13260 AP2_ERF EDF4, RAV1 ETHYLENE RESPONSE DNA BINDING ... Lus10041487 2.0 0.8022
AT3G47640 bHLH PYE, bHLH047, P... POPEYE, basic helix-loop-helix... Lus10024233 2.6 0.8311
AT2G01818 PLATZ transcription factor fam... Lus10003680 5.2 0.8053
AT2G32810 BGAL9 beta-galactosidase 9, beta gal... Lus10016655 13.0 0.7817
AT4G16600 Nucleotide-diphospho-sugar tra... Lus10004717 14.0 0.8066
AT1G53050 Protein kinase superfamily pro... Lus10031651 14.8 0.7639
AT5G17680 disease resistance protein (TI... Lus10030345 15.5 0.7989
AT1G30755 Protein of unknown function (D... Lus10017259 15.9 0.7481
AT2G27500 Glycosyl hydrolase superfamily... Lus10020618 19.3 0.7241
AT3G09920 PIP5K9 phosphatidyl inositol monophos... Lus10023909 19.5 0.7639

Lus10008518 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.