Lus10008522 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G23730 422 / 2e-150 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1)
AT4G14130 418 / 1e-148 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
AT4G25810 359 / 2e-125 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
AT4G30270 356 / 2e-124 XTH24, SEN4, BRU1, MERI-5, MERI5B SENESCENCE 4, meristem-5, MERISTEM 5, xyloglucan endotransglucosylase/hydrolase 24 (.1)
AT5G57530 354 / 1e-123 AtXTH12, XTH12 xyloglucan endotransglucosylase/hydrolase 12 (.1)
AT5G57560 351 / 2e-122 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1)
AT5G57540 351 / 2e-122 AtXTH13, XTH13 xyloglucan endotransglucosylase/hydrolase 13 (.1)
AT5G57550 349 / 1e-121 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1)
AT4G25820 342 / 1e-118 ATXTH14, XTR9, XTH14 xyloglucan endotransglycosylase 9, xyloglucan endotransglucosylase/hydrolase 14 (.1)
AT2G18800 325 / 9e-112 ATXTH21, XTH21, XTR17 xyloglucan endotransglucosylase/hydrolase 21 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004723 548 / 0 AT3G23730 431 / 1e-153 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10028947 425 / 1e-151 AT4G14130 437 / 2e-156 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Lus10000678 414 / 4e-147 AT3G23730 410 / 6e-146 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10021638 410 / 2e-145 AT3G23730 413 / 7e-147 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10007349 365 / 8e-128 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10020772 362 / 1e-126 AT3G23730 393 / 7e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10023221 360 / 2e-125 AT3G23730 376 / 4e-132 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010938 358 / 4e-125 AT4G14130 386 / 3e-136 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Lus10020773 358 / 7e-125 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G146100 426 / 8e-152 AT3G23730 451 / 1e-161 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.002G236200 417 / 1e-148 AT3G23730 436 / 1e-155 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.005G201250 397 / 3e-140 AT4G14130 395 / 2e-139 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.005G201200 395 / 1e-139 AT4G14130 405 / 2e-143 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G060500 392 / 1e-138 AT4G14130 424 / 3e-151 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G060400 385 / 1e-135 AT4G14130 402 / 2e-142 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.013G005700 380 / 5e-133 AT4G25810 431 / 5e-153 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.011G077320 376 / 3e-132 AT3G23730 386 / 7e-136 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.018G095100 367 / 1e-128 AT4G25810 420 / 1e-149 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G095200 363 / 5e-127 AT4G25810 414 / 3e-147 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Lus10008522 pacid=23177354 polypeptide=Lus10008522 locus=Lus10008522.g ID=Lus10008522.BGIv1.0 annot-version=v1.0
ATGGGCAACTTTTCTACTCAAAGTCTTGTGCTTTGTGCTCTGGTTCTGACGGTGATCGGAGCCACCGGAGCCAATGGCGGAAGCTTCTACGACGATTTTG
ATCTAACGTGGGGAGGACCACGGTCCAAGATTTTCGGAGGCGGCCAGATGCTGTCTCTGTCTCTGGATAAGGCGTCCGGGTCCGGATTCCAATCCAAGAA
GGAGTACTTGTTCGGGAGGATCGACATGCAGCTTAAGCTCGTGGCCGGTAACTCCGCGGGCACCGTCACGGCTTATTACTTGTCGTCACAGGGTCCGACC
CATGACGAAATTGATTTTGAATTCTTGGGGAATTCGAGCGGGGATCCTTATATTTTGCACACGAACGTGTTCGCTCTAGGGAAAGGAGGCAAAGAGCAAC
AGTTTTATCTTTGGTTCGATCCGACGAGGAACTTCCACACTTATTCCATCGTTTGGAAGCCTCAACACATCATATTCCTGGTGGACAACACTCCGATCAG
GGTGTTCAACAACGCGGAGAACCGAGGGGTGGCGTTCCCCAAGAACCAGCCGATGAGGATCTACTCGAGTCTATGGAACGCGGACGACTGGGCCACCCGG
GGCGGTCTGGTCAAGACCGACTGGTCAAAGGCTCCATTCACTGCTTACTACAGGAACTTCAGAGTCACTACTACTAATGCTTCCCCTGTTTCATCTTCTT
CCTCTGGCTCGTTTGGCAATGGCGATTGGCAGAGGAAGAACAACAATGGTGATCAGTTGGATGCTAACTCGAGGAGGAGGCTGAGATGGGTTCAGAAGAA
TTTTATGATTTATAACTATTGTACTGATTTCAAACGGTTCCCTCAGGGGCTTCCTACTGAGTGTAAATGA
AA sequence
>Lus10008522 pacid=23177354 polypeptide=Lus10008522 locus=Lus10008522.g ID=Lus10008522.BGIv1.0 annot-version=v1.0
MGNFSTQSLVLCALVLTVIGATGANGGSFYDDFDLTWGGPRSKIFGGGQMLSLSLDKASGSGFQSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQGPT
HDEIDFEFLGNSSGDPYILHTNVFALGKGGKEQQFYLWFDPTRNFHTYSIVWKPQHIIFLVDNTPIRVFNNAENRGVAFPKNQPMRIYSSLWNADDWATR
GGLVKTDWSKAPFTAYYRNFRVTTTNASPVSSSSSGSFGNGDWQRKNNNGDQLDANSRRRLRWVQKNFMIYNYCTDFKRFPQGLPTECK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G23730 XTH16 xyloglucan endotransglucosylas... Lus10008522 0 1
AT3G54880 unknown protein Lus10013824 8.9 0.7052
AT5G42180 PER64 peroxidase 64, Peroxidase supe... Lus10005614 9.2 0.7210
Lus10032489 9.8 0.6680
AT5G62040 BFT brother of FT and TFL1, PEBP (... Lus10005753 10.8 0.7009
AT5G60920 COB COBRA-like extracellular glyco... Lus10007986 14.8 0.6393
AT3G59440 Calcium-binding EF-hand family... Lus10020171 16.3 0.7394
AT5G52060 ATBAG1 BCL-2-associated athanogene 1 ... Lus10029598 16.5 0.6833
AT5G66430 S-adenosyl-L-methionine-depend... Lus10036548 44.4 0.6445
AT2G37170 PIP2;2, PIP2B PLASMA MEMBRANE INTRINSIC PROT... Lus10019934 49.5 0.6738
AT2G36870 XTH32 xyloglucan endotransglucosylas... Lus10013822 60.7 0.6740

Lus10008522 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.