Plant FIBer expression Database

Lus10008532 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G52905 156 / 1e-49 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008496
[exp]
251 / 7e-87 AT3G52905 175 / 5e-56 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G104800
[exp]
168 / 3e-54 AT3G52905 219 / 7e-74 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0580 YqgF PF03652 RuvX Holliday junction resolvase
Representative CDS sequence
>Lus10008532 pacid=23177367 polypeptide=Lus10008532 locus=Lus10008532.g ID=Lus10008532.BGIv1.0 annot-version=v1.0
ATGAAGTACAGGAATGCTTTGATGTTGGCTCGCTTCCTCAGAACGAAACAGGATGGTAGGTTGCTTGGATTGGATGTTGGGGAGAAGTATGTCGGCCTAG
CTATATCTGATTCCCGGAACAAAATTGCATCACCTTTAAGTGTTGTGGTGAGAAAGAAATCCAATGTTCACTTGATGGCTGAGGATTTCCAGAACCTGGT
CTCTGAACTTTCTCTGGCTGGATTTGTTGTAGGGTGCCCGATGGGCAGATTATGTAAGCCTACAGATATGAACAAGGTGAAGCTTTTTGTGGATGACATC
TCTAGAACAGGGAAGCTAAAGGATGTAAAGTATACTTACTGGAACGAGTGCTTTACATCGAAGGTCATTCAGTGTCTGGTGGAGCCGATGAATTTTCATC
CTTGTGAAGCATAA
AA sequence
>Lus10008532 pacid=23177367 polypeptide=Lus10008532 locus=Lus10008532.g ID=Lus10008532.BGIv1.0 annot-version=v1.0
MKYRNALMLARFLRTKQDGRLLGLDVGEKYVGLAISDSRNKIASPLSVVVRKKSNVHLMAEDFQNLVSELSLAGFVVGCPMGRLCKPTDMNKVKLFVDDI
SRTGKLKDVKYTYWNECFTSKVIQCLVEPMNFHPCEA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G52905 Polynucleotidyl transferase, r... Lus10008532
[exp]
0 1
AT1G67580 CDKG;2 Protein kinase superfamily pro... Lus10015816
[exp]
11.2 0.8772
Lus10006006
[exp]
11.5 0.8857
AT2G45500 AAA-type ATPase family protein... Lus10038001
[exp]
14.3 0.8516
AT1G17720 ATBBETA, ATB BE... Protein phosphatase 2A, regula... Lus10001239
[exp]
16.4 0.8742
AT4G38470 STY46 serine/threonine/tyrosine kina... Lus10023989
[exp]
17.4 0.8762
AT5G49530 SIN-like family protein (.1) Lus10041724
[exp]
17.7 0.8476
AT3G12100 Cation efflux family protein (... Lus10021058
[exp]
19.0 0.8485
AT4G09730 RH39 RH39 (.1) Lus10018946
[exp]
24.1 0.8719
AT3G48530 KING1 SNF1-related protein kinase re... Lus10016763
[exp]
26.5 0.8520
AT3G07310 Protein of unknown function (D... Lus10025896
[exp]
31.1 0.8727

Lus10008532 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.