Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G11600 99 / 3e-27 LSC803, PHGPX, ATGPX6 glutathione peroxidase 6 (.1) AT1G63460 94 / 3e-26 ATGPX8 glutathione peroxidase 8 (.1) AT3G63080 92 / 2e-25 ATGPX5, MEE42 maternal effect embryo arrest 42, glutathione peroxidase 5 (.1) AT4G31870 92 / 1e-24 ATGPX7 glutathione peroxidase 7 (.1) AT2G25080 91 / 4e-24 ATGPX1 glutathione peroxidase 1 (.1) AT2G48150 86 / 6e-23 ATGPX4 glutathione peroxidase 4 (.1) AT2G31570 83 / 7e-22 ATGPX2 glutathione peroxidase 2 (.1) AT2G43350 78 / 1e-19 ATGPX3 glutathione peroxidase 3 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008537 [exp] 113 / 1e-33 AT4G11600 299 / 1e-104 glutathione peroxidase 6 (.1) Lus10008499 [exp] 114 / 3e-33 AT4G11600 307 / 2e-106 glutathione peroxidase 6 (.1) Lus10008022 [exp] 104 / 3e-30 AT4G11600 301 / 1e-105 glutathione peroxidase 6 (.1) Lus10042692 [exp] 92 / 1e-25 AT2G48150 188 / 2e-62 glutathione peroxidase 4 (.1) Lus10000601 [exp] 91 / 4e-25 AT1G63460 256 / 2e-88 glutathione peroxidase 8 (.1) Lus10008023 [exp] 94 / 5e-25 AT1G63460 265 / 9e-91 glutathione peroxidase 8 (.1) Lus10029651 [exp] 90 / 1e-24 AT2G48150 274 / 2e-95 glutathione peroxidase 4 (.1) Lus10000603 [exp] 89 / 4e-24 AT4G11600 256 / 9e-88 glutathione peroxidase 6 (.1) Lus10042418 [exp] 90 / 1e-23 AT4G31870 329 / 2e-115 glutathione peroxidase 7 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G105200 [exp] 107 / 3e-31 AT4G11600 298 / 3e-104 glutathione peroxidase 6 (.1) Potri.003G126100 [exp] 105 / 7e-30 AT4G11600 307 / 9e-107 glutathione peroxidase 6 (.1) Potri.001G105100 [exp] 93 / 1e-25 AT1G63460 283 / 5e-99 glutathione peroxidase 8 (.1) Potri.006G265400 [exp] 90 / 5e-24 AT2G25080 343 / 6e-121 glutathione peroxidase 1 (.1) Potri.014G138800 [exp] 88 / 7e-24 AT2G48150 271 / 1e-94 glutathione peroxidase 4 (.1) Potri.018G017500 [exp] 82 / 2e-21 AT2G25080 209 / 4e-69 glutathione peroxidase 1 (.1) Potri.007G126600 [exp] 82 / 3e-21 AT2G31570 281 / 1e-97 glutathione peroxidase 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [flax] [poplar] Thioredoxin PF00255 [flax] [poplar] GSHPx Glutathione peroxidase
Representative CDS sequence Show only first row Show all	>Lus10008534 pacid=23177363 polypeptide=Lus10008534 locus=Lus10008534.g ID=Lus10008534.BGIv1.0 annot-version=v1.0 ATGTCGCCTCCCAATGGTAATTTCTTCACTGAGGGTGGCTTGACCAATTCGAACTACACTCAGCTGACTGAGCTGTACAAGAAATATAAGGATCAAGGTC TACAGATCTTGGCTTTCCCTTGCAATCAGTTTGGATCTCAGGAGCCTGGCAGCAACGAGCAAATCATGGAGTTTGCTTGTACTCGCTTCAAGGCAGTACC TCCCCTCCAGCTTCGAGACTAG
AA sequence Show only first row Show all	>Lus10008534 pacid=23177363 polypeptide=Lus10008534 locus=Lus10008534.g ID=Lus10008534.BGIv1.0 annot-version=v1.0 MSPPNGNFFTEGGLTNSNYTQLTELYKKYKDQGLQILAFPCNQFGSQEPGSNEQIMEFACTRFKAVPPLQLRD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G63460		ATGPX8	glutathione peroxidase 8 (.1)		Lus10008534 [exp]	0	1
AT4G25950		VATG3	vacuolar ATP synthase G3 (.1)		Lus10001543 [exp]	1.7	0.9512
AT5G41460			Protein of unknown function (D...		Lus10018123 [exp]	4.2	0.9525
AT1G69180	YABBY	CRC	CRABS CLAW, Plant-specific tra...		Lus10036811 [exp]	5.5	0.9315
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10008921 [exp]	5.7	0.9409
					Lus10014008 [exp]	6.0	0.9107
AT1G02050		LAP6	LESS ADHESIVE POLLEN 6, Chalco...		Lus10039904 [exp]	6.3	0.9276
					Lus10029087 [exp]	7.7	0.9149
AT1G75880		EXL1	SGNH hydrolase-type esterase s...		Lus10003719 [exp]	9.5	0.9189
AT1G11545		XTH8	xyloglucan endotransglucosylas...		Lus10007645 [exp]	9.5	0.9291
AT4G23180		RLK4, CRK10	cysteine-rich RLK (RECEPTOR-li...		Lus10034971 [exp]	10.7	0.9717

Compare expression of checked genes

Lus10008534 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.