Lus10008537 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G11600 299 / 1e-104 LSC803, PHGPX, ATGPX6 glutathione peroxidase 6 (.1)
AT1G63460 250 / 2e-86 ATGPX8 glutathione peroxidase 8 (.1)
AT4G31870 251 / 1e-85 ATGPX7 glutathione peroxidase 7 (.1)
AT2G31570 243 / 2e-83 ATGPX2 glutathione peroxidase 2 (.1)
AT2G25080 243 / 1e-82 ATGPX1 glutathione peroxidase 1 (.1)
AT3G63080 238 / 3e-81 ATGPX5, MEE42 maternal effect embryo arrest 42, glutathione peroxidase 5 (.1)
AT2G43350 238 / 5e-81 ATGPX3 glutathione peroxidase 3 (.1.2)
AT2G48150 232 / 6e-79 ATGPX4 glutathione peroxidase 4 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008499 349 / 3e-124 AT4G11600 307 / 2e-106 glutathione peroxidase 6 (.1)
Lus10008022 316 / 4e-112 AT4G11600 301 / 1e-105 glutathione peroxidase 6 (.1)
Lus10000603 271 / 1e-94 AT4G11600 256 / 9e-88 glutathione peroxidase 6 (.1)
Lus10008023 258 / 6e-88 AT1G63460 265 / 9e-91 glutathione peroxidase 8 (.1)
Lus10027021 252 / 8e-87 AT2G31570 266 / 2e-92 glutathione peroxidase 2 (.1)
Lus10000601 249 / 9e-86 AT1G63460 256 / 2e-88 glutathione peroxidase 8 (.1)
Lus10042418 249 / 7e-85 AT4G31870 329 / 2e-115 glutathione peroxidase 7 (.1)
Lus10026887 248 / 4e-84 AT4G31870 332 / 3e-116 glutathione peroxidase 7 (.1)
Lus10029651 244 / 1e-83 AT2G48150 274 / 2e-95 glutathione peroxidase 4 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G126100 310 / 5e-109 AT4G11600 307 / 9e-107 glutathione peroxidase 6 (.1)
Potri.001G105200 307 / 1e-108 AT4G11600 298 / 3e-104 glutathione peroxidase 6 (.1)
Potri.001G105100 271 / 2e-94 AT1G63460 283 / 5e-99 glutathione peroxidase 8 (.1)
Potri.007G126600 261 / 6e-90 AT2G31570 281 / 1e-97 glutathione peroxidase 2 (.1)
Potri.006G265400 247 / 4e-84 AT2G25080 343 / 6e-121 glutathione peroxidase 1 (.1)
Potri.014G138800 235 / 3e-80 AT2G48150 271 / 1e-94 glutathione peroxidase 4 (.1)
Potri.018G017500 164 / 2e-52 AT2G25080 209 / 4e-69 glutathione peroxidase 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF00255 GSHPx Glutathione peroxidase
Representative CDS sequence
>Lus10008537 pacid=23177362 polypeptide=Lus10008537 locus=Lus10008537.g ID=Lus10008537.BGIv1.0 annot-version=v1.0
ATGGCCAGCAACTCCAAAGCTCCTCAGTCCATTTACGACTTCACTGTCAAGGACGCTAGAGGGAATGATGTTGATCTCAGTACTTACAAGGGCAAAGTTC
TTTTGATTGTCAATGTCGCCTCCCAATGTGGCTTGACCAATTCGAATTACACTGAGCTGACTGAGCTGTACAAGAAATACAAAGATCAAGGCCTAGAGAT
CTTGGCTTTCCCTTGCAATCAGTTTGGATCTCAGGAACCTGGAAGCAACGAGCAAATCATGGAGTTTGCTTGTACTCGCTTCAAGGCCGAGTACCCCATT
TTCGACAAGGTTGATGTGAACGGGAACAATGCTGCTCCAATCTACAAGTTCCTCAAGTCAAGCAAAGGTGGCCTCTTTGGGGATGGTATCAAGTGGAACT
TTGCCAAGTTCCTCATCAACAAAGAGGGGCAGGTGGTCGATCGCTATGCTCCTACTACCTCCCCTCTCAGCTTCGAGAAAGATGTGAAAAAACTGCTTGG
GGTTGCCTAG
AA sequence
>Lus10008537 pacid=23177362 polypeptide=Lus10008537 locus=Lus10008537.g ID=Lus10008537.BGIv1.0 annot-version=v1.0
MASNSKAPQSIYDFTVKDARGNDVDLSTYKGKVLLIVNVASQCGLTNSNYTELTELYKKYKDQGLEILAFPCNQFGSQEPGSNEQIMEFACTRFKAEYPI
FDKVDVNGNNAAPIYKFLKSSKGGLFGDGIKWNFAKFLINKEGQVVDRYAPTTSPLSFEKDVKKLLGVA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G11600 LSC803, PHGPX, ... glutathione peroxidase 6 (.1) Lus10008537 0 1
AT5G13810 Glutaredoxin family protein (.... Lus10024164 2.4 0.9073
AT3G17940 Galactose mutarotase-like supe... Lus10005808 15.2 0.9094
AT3G43790 ZIFL2 zinc induced facilitator-like ... Lus10037425 15.7 0.9086
AT1G04700 PB1 domain-containing protein ... Lus10003184 20.7 0.8651
AT1G06620 2-oxoglutarate (2OG) and Fe(II... Lus10027585 26.1 0.8916
AT4G04960 Concanavalin A-like lectin pro... Lus10018602 27.3 0.8857
AT3G56880 VQ motif-containing protein (.... Lus10015982 27.7 0.8714
AT2G18210 unknown protein Lus10041771 29.7 0.9051
AT1G07530 GRAS SCL14, ATGRAS2 GRAS \(GAI, RGA, SCR\) 2, ARAB... Lus10001577 31.5 0.8725
AT5G40010 ASD, AATP1 ATPase-in-Seed-Development, AA... Lus10014496 33.3 0.8505

Lus10008537 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.