Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G50740 152 / 8e-49 Transmembrane proteins 14C (.1) AT3G20510 149 / 1e-47 Transmembrane proteins 14C (.1) AT3G57280 70 / 1e-15 Transmembrane proteins 14C (.1) AT2G26240 55 / 1e-10 Transmembrane proteins 14C (.1) AT3G43520 45 / 2e-06 Transmembrane proteins 14C (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019624 [exp] 200 / 8e-68 AT1G50740 177 / 8e-59 Transmembrane proteins 14C (.1) Lus10035434 [exp] 64 / 6e-13 AT2G43080 365 / 4e-125 P4H isoform 1 (.1) Lus10031047 [exp] 39 / 0.0004 AT3G57280 132 / 6e-37 Transmembrane proteins 14C (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G424000 [exp] 170 / 4e-56 AT1G50740 158 / 2e-51 Transmembrane proteins 14C (.1) Potri.011G138100 [exp] 166 / 3e-54 AT1G50740 128 / 1e-39 Transmembrane proteins 14C (.1) Potri.003G094300 [exp] 70 / 2e-15 AT3G57280 214 / 3e-70 Transmembrane proteins 14C (.1) Potri.001G139800 [exp] 67 / 1e-14 AT3G57280 172 / 5e-54 Transmembrane proteins 14C (.1) Potri.006G108700 [exp] 51 / 2e-08 AT2G38550 275 / 7e-91 Transmembrane proteins 14C (.1) Potri.016G137200 [exp] 51 / 2e-08 AT2G38550 263 / 4e-86 Transmembrane proteins 14C (.1) Potri.006G217400 [exp] 42 / 2e-05 AT3G43520 161 / 7e-49 Transmembrane proteins 14C (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03647 [flax] [poplar] Tmemb_14 Transmembrane proteins 14C
Representative CDS sequence Show only first row Show all	>Lus10008541 pacid=23160993 polypeptide=Lus10008541 locus=Lus10008541.g ID=Lus10008541.BGIv1.0 annot-version=v1.0 ATGCACGATTTCTGCTTCACGATCCCGTACGGGCTGATTCTAGTGGCAGGGGGAGTAGTTGGGTTTCTGAAGAAAGGGAGCGTCACATCCCTCGGTGGTG GCGCTGGAGCTGGATTTCTACTAATCTTAGCTGGGTATTTGAGTCTTAAGGCTTTCCAGAAAAGAAAGAACAATTATTTCGCTTTAGCCATCGAAACTGT TTGTGCCGCTGCTCTCACATTCCTTATGGGGCAACGTTACATTCAAACCTCCAAGATTATGCCTGCTGGTCTTGTTGCTGCTATCAGTGGTCTCATGACT GTATTTTATCTGTATAAAGTTGCCACCGGCGGCAACCACATTCCAAGCAAGGCTGAGTGA
AA sequence Show only first row Show all	>Lus10008541 pacid=23160993 polypeptide=Lus10008541 locus=Lus10008541.g ID=Lus10008541.BGIv1.0 annot-version=v1.0 MHDFCFTIPYGLILVAGGVVGFLKKGSVTSLGGGAGAGFLLILAGYLSLKAFQKRKNNYFALAIETVCAAALTFLMGQRYIQTSKIMPAGLVAAISGLMT VFYLYKVATGGNHIPSKAE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G50740			Transmembrane proteins 14C (.1...		Lus10008541 [exp]	0	1
AT1G10430		PP2A-2	protein phosphatase 2A-2 (.1)		Lus10013287 [exp]	3.3	0.9376
AT1G27450		APRT, ATAPT1, A...	ARABIDOPSIS THALIANA ADENINE P...		Lus10007757 [exp]	4.9	0.9355
AT1G10430		PP2A-2	protein phosphatase 2A-2 (.1)		Lus10030810 [exp]	6.5	0.9372
AT1G23440			Peptidase C15, pyroglutamyl pe...		Lus10029137 [exp]	6.7	0.9322
AT4G33950		ATOST1, P44, SR...	SNF1-RELATED PROTEIN KINASE 2....		Lus10004382 [exp]	10.4	0.9242
AT2G26210			Ankyrin repeat family protein ...		Lus10033419 [exp]	10.4	0.8803
AT3G02875		ILR1	IAA-LEUCINE RESISTANT 1, Pepti...		Lus10021321 [exp]	12.4	0.9272
AT3G10150		ATPAP16, PAP16	purple acid phosphatase 16 (.1...		Lus10018030 [exp]	12.4	0.9133
AT3G26980		MUB4	membrane-anchored ubiquitin-fo...		Lus10035184 [exp]	13.0	0.8988
AT1G23440			Peptidase C15, pyroglutamyl pe...		Lus10013026 [exp]	13.4	0.9336

Compare expression of checked genes

Lus10008541 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.