Lus10008543 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G02870 53 / 4e-09 unknown protein
AT1G78640 50 / 4e-08 unknown protein
AT2G33720 42 / 4e-05 AP2/B3-like transcriptional factor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027591 156 / 3e-48 AT4G02870 75 / 2e-15 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G099600 55 / 4e-10 AT2G33720 112 / 7e-30 AP2/B3-like transcriptional factor family protein (.1)
Potri.003G191700 52 / 5e-09 AT2G33720 110 / 3e-28 AP2/B3-like transcriptional factor family protein (.1)
Potri.003G191901 51 / 2e-08 AT2G33720 119 / 7e-32 AP2/B3-like transcriptional factor family protein (.1)
PFAM info
Representative CDS sequence
>Lus10008543 pacid=23161015 polypeptide=Lus10008543 locus=Lus10008543.g ID=Lus10008543.BGIv1.0 annot-version=v1.0
ATGCCGGTGTTGACCAGAGAAGAGAAGGAGAGACTGGTCAACAATCGCGCGGTGGAGGTTCGTTTGTGGGACGTGGACACCCGGAGCAGGCACGATCTGT
CGCTGGAGCGGCTGAAAGTGCAGTTCCGGTCAAAGGTACACTGTGTAATCGGGCTCGGAGGGGACTGGAACGAGGAGCTTGTAAAGAGGAGGGGGTTGAA
GGAAGGAGACGAGGTTGGTTTCTGTTGGGATCAAAAAGCTTCTCGTTTCGATTTTCGATTGATTGCGCCATCTCCCAAGCTAACGATAATGATATCGATC
CATACAGTGTTTGGGGGAGGATATGTTTCGTTTATTTATTATTATTATTATGAGCTGCCTATGTAA
AA sequence
>Lus10008543 pacid=23161015 polypeptide=Lus10008543 locus=Lus10008543.g ID=Lus10008543.BGIv1.0 annot-version=v1.0
MPVLTREEKERLVNNRAVEVRLWDVDTRSRHDLSLERLKVQFRSKVHCVIGLGGDWNEELVKRRGLKEGDEVGFCWDQKASRFDFRLIAPSPKLTIMISI
HTVFGGGYVSFIYYYYYELPM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G02870 unknown protein Lus10008543 0 1
AT1G33670 Leucine-rich repeat (LRR) fami... Lus10041065 4.2 0.8823
AT2G42430 AS2 ASL18, LBD16 ASYMMETRIC LEAVES2-LIKE 18, la... Lus10033872 10.2 0.8609
AT3G51660 Tautomerase/MIF superfamily pr... Lus10000344 23.8 0.8820
AT4G26200 ACS7, ATACS7 1-amino-cyclopropane-1-carboxy... Lus10032695 25.6 0.8513
AT1G70570 anthranilate phosphoribosyltra... Lus10006201 27.2 0.8562
AT4G36360 BGAL3 beta-galactosidase 3 (.1.2) Lus10020968 33.9 0.8361
AT1G13550 Protein of unknown function (D... Lus10031914 80.7 0.8388
AT1G71910 unknown protein Lus10016934 137.1 0.8051
AT3G25810 Terpenoid cyclases/Protein pre... Lus10039711 144.5 0.8097
AT5G52830 WRKY ATWRKY27, WRKY2... ARABIDOPSIS THALIANA WRKY DNA-... Lus10027538 150.7 0.8145

Lus10008543 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.