Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G55160 54 / 3e-10 unknown protein AT2G19530 45 / 1e-06 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019322 [exp] 38 / 0.0004 AT1G55160 126 / 3e-37 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G151200 [exp] 52 / 3e-09 AT1G55160 90 / 7e-24 unknown protein Potri.001G200200 [exp] 43 / 7e-06 AT1G55160 140 / 2e-42 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10008559 pacid=23160986 polypeptide=Lus10008559 locus=Lus10008559.g ID=Lus10008559.BGIv1.0 annot-version=v1.0 ATGGTGGGTTCTCAAGATCCACACCCTTCTGCTTCTTCAATAGCTGCCCTTGTCCATCGGAGAAAACTAATTTGGCGAGTTGCCTTGATCTGCAACTTCG GTATCGGAGCTTATATATTTGCTCTGGCAGCAAGCAAGAAGAATGGGGGATCGGAAGTTCAAAAGGCAGGAAAGAGAAGTAGTAGTGTATCAAAGGCTAA ATCTTTACCGGAAGAGAACTTGAAGGATCCTTATGATTCAATACGAGCATCTCTTCCTCACGATGAGCAGCAGCAGCAGCAGCATAAGATGTTGGAAGAG AAGCGGCAGTTTGAACCTCAAGAGGACAAACGAATTCTGCAACAATTCATGGGACCGTCTAAGCTTCCTTGA
AA sequence Show only first row Show all	>Lus10008559 pacid=23160986 polypeptide=Lus10008559 locus=Lus10008559.g ID=Lus10008559.BGIv1.0 annot-version=v1.0 MVGSQDPHPSASSIAALVHRRKLIWRVALICNFGIGAYIFALAASKKNGGSEVQKAGKRSSSVSKAKSLPEENLKDPYDSIRASLPHDEQQQQQHKMLEE KRQFEPQEDKRILQQFMGPSKLP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G55160			unknown protein		Lus10008559 [exp]	0	1
AT5G66600			Protein of unknown function, D...		Lus10016786 [exp]	43.5	0.7870
AT1G15030			Protein of unknown function (D...		Lus10033747 [exp]	61.1	0.7833
AT1G03330			Small nuclear ribonucleoprotei...		Lus10000666 [exp]	63.5	0.7811
AT4G32050			neurochondrin family protein (...		Lus10023067 [exp]	64.9	0.7722
AT1G01150			Homeodomain-like protein with ...		Lus10026308 [exp]	87.3	0.7650
AT4G16510			YbaK/aminoacyl-tRNA synthetase...		Lus10000734 [exp]	88.9	0.7370
AT3G44590			60S acidic ribosomal protein f...		Lus10026712 [exp]	110.2	0.7365
AT1G63460		ATGPX8	glutathione peroxidase 8 (.1)		Lus10008023 [exp]	159.6	0.7459
AT5G40280		ATFTB, WIG, ERA...	WIGGUM, ENHANCED RESPONSE TO A...		Lus10014536 [exp]	168.3	0.7357
AT3G56840			FAD-dependent oxidoreductase f...		Lus10033520 [exp]	177.8	0.7257

Compare expression of checked genes

Lus10008559 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.