Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G58375 68 / 2e-16 Methyltransferase-related protein (.1) AT5G14602 57 / 2e-12 unknown protein AT5G18150 56 / 6e-12 Methyltransferase-related protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042227 [exp] 120 / 4e-37 AT5G58375 91 / 2e-25 Methyltransferase-related protein (.1) Lus10020287 [exp] 58 / 2e-12 AT5G18150 109 / 4e-33 Methyltransferase-related protein (.1) Lus10005698 [exp] 56 / 7e-12 AT5G18150 108 / 1e-32 Methyltransferase-related protein (.1) Lus10034423 [exp] 54 / 5e-11 AT5G18150 87 / 5e-24 Methyltransferase-related protein (.1) Lus10019138 [exp] 52 / 8e-10 AT5G18150 80 / 3e-21 Methyltransferase-related protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G155800 [exp] 66 / 2e-15 AT5G58375 67 / 5e-16 Methyltransferase-related protein (.1) Potri.019G127900 [exp] 64 / 1e-14 AT5G58375 64 / 6e-15 Methyltransferase-related protein (.1) Potri.013G058200 [exp] 58 / 1e-12 AT5G18150 114 / 5e-35 Methyltransferase-related protein (.1) Potri.019G035000 [exp] 57 / 4e-12 AT5G18150 109 / 4e-33 Methyltransferase-related protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10008585 pacid=23180095 polypeptide=Lus10008585 locus=Lus10008585.g ID=Lus10008585.BGIv1.0 annot-version=v1.0 ATGTGCCCTCTCCGCATCATTCTCGTCTTCCTCTCCGCCACTCTCGCCGGCTTCTTCCTCTTCCGCAACCTCAACTCCCAAACTCCTCTCGCCGACGACG ATCACCGCGACTCCTCTTCAGCTGAATCCTCCTCATCCTCCTCCACTAGTCGATTGTCCAAGCTCCGGTCAGCTGTGGAGTCCGGGTTCTGGACCGGCGT TGACATGGCCAGTGGACGTTACCTCTGGAGACATTTGACGGCCGCTTCTTCGTCTACTCCAGAAGCTCGTGATCCATCTGATTAG
AA sequence Show only first row Show all	>Lus10008585 pacid=23180095 polypeptide=Lus10008585 locus=Lus10008585.g ID=Lus10008585.BGIv1.0 annot-version=v1.0 MCPLRIILVFLSATLAGFFLFRNLNSQTPLADDDHRDSSSAESSSSSSTSRLSKLRSAVESGFWTGVDMASGRYLWRHLTAASSSTPEARDPSD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G58375			Methyltransferase-related prot...		Lus10008585 [exp]	0	1
AT5G13810			Glutaredoxin family protein (....		Lus10039537 [exp]	1.0	0.9409
AT5G60570			Galactose oxidase/kelch repeat...		Lus10037413 [exp]	1.4	0.9325
AT5G64510		TIN1	tunicamycin induced 1, unknown...		Lus10012458 [exp]	4.5	0.9118
AT4G32020			unknown protein		Lus10005344 [exp]	5.5	0.9224
AT3G15040			Protein of unknown function, D...		Lus10034190 [exp]	7.7	0.8944
AT4G09890			Protein of unknown function (D...		Lus10028734 [exp]	7.7	0.9192
AT3G25590			unknown protein		Lus10034409 [exp]	7.9	0.9268
AT1G24620			EF hand calcium-binding protei...		Lus10004330 [exp]	14.4	0.8345
AT2G41430		LSR1, CID1, ERD...	CTC-Interacting Domain 1, dehy...		Lus10019769 [exp]	14.9	0.8744
AT1G62710		BETAVPE, BETA-V...	beta vacuolar processing enzym...		Lus10024599 [exp]	16.4	0.9244

Compare expression of checked genes

Lus10008585 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.