Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G60870 231 / 2e-77 RUG3 RCC1/UVR8/GEF-like 3, Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2), Regulator of chromosome condensation (RCC1) family protein (.3) AT3G02510 91 / 5e-22 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2) AT5G16040 87 / 1e-20 Regulator of chromosome condensation (RCC1) family protein (.1) AT5G08710 85 / 8e-20 RUG1 RCC1/UVR8/GEF-like 1, Regulator of chromosome condensation (RCC1) family protein (.1) AT5G63860 79 / 1e-17 UVR8 UVB-RESISTANCE 8, Regulator of chromosome condensation (RCC1) family protein (.1) AT5G19420 73 / 2e-15 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) AT5G42140 72 / 4e-15 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) AT1G76950 71 / 8e-15 PRAF1 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) AT5G12350 71 / 9e-15 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) AT3G03790 71 / 1e-14 ankyrin repeat family protein / regulator of chromosome condensation (RCC1) family protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042215 [exp] 318 / 7e-109 AT5G60870 547 / 0.0 RCC1/UVR8/GEF-like 3, Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2), Regulator of chromosome condensation (RCC1) family protein (.3) Lus10039618 [exp] 81 / 4e-18 AT5G63860 715 / 0.0 UVB-RESISTANCE 8, Regulator of chromosome condensation (RCC1) family protein (.1) Lus10029536 [exp] 81 / 4e-18 AT5G63860 642 / 0.0 UVB-RESISTANCE 8, Regulator of chromosome condensation (RCC1) family protein (.1) Lus10008601 [exp] 76 / 8e-17 AT5G60870 321 / 5e-108 RCC1/UVR8/GEF-like 3, Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2), Regulator of chromosome condensation (RCC1) family protein (.3) Lus10030712 [exp] 76 / 3e-16 AT3G02300 717 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1) Lus10013197 [exp] 74 / 1e-15 AT3G02300 711 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1) Lus10033543 [exp] 73 / 1e-15 AT3G02510 648 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2) Lus10017581 [exp] 73 / 2e-15 AT3G02510 636 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2) Lus10006242 [exp] 71 / 1e-14 AT3G26100 796 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G000600 [exp] 251 / 7e-83 AT5G60870 534 / 0.0 RCC1/UVR8/GEF-like 3, Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2), Regulator of chromosome condensation (RCC1) family protein (.3) Potri.004G101800 [exp] 89 / 3e-21 AT5G16040 665 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1) Potri.017G113200 [exp] 84 / 2e-19 AT5G16040 676 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1) Potri.007G100200 [exp] 82 / 7e-19 AT5G63860 738 / 0.0 UVB-RESISTANCE 8, Regulator of chromosome condensation (RCC1) family protein (.1) Potri.008G167500 [exp] 75 / 4e-16 AT4G14368 1266 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1) Potri.016G101700 [exp] 73 / 1e-15 AT3G53830 547 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1) Potri.005G071000 [exp] 72 / 2e-15 AT5G08710 515 / 0.0 RCC1/UVR8/GEF-like 1, Regulator of chromosome condensation (RCC1) family protein (.1) Potri.017G099900 [exp] 71 / 7e-15 AT3G02300 711 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1) Potri.005G190000 [exp] 71 / 1e-14 AT5G42140 1407 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) Potri.017G139600 [exp] 68 / 7e-14 AT1G65920 937 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0186 [flax] [poplar] Beta_propeller PF00415 [flax] [poplar] RCC1 Regulator of chromosome condensation (RCC1) repeat
Representative CDS sequence Show only first row Show all	>Lus10008599 pacid=23180107 polypeptide=Lus10008599 locus=Lus10008599.g ID=Lus10008599.BGIv1.0 annot-version=v1.0 ATGGCTAACTCAAACTATGAGCTTGGAAGAGGCAATAAGGTTGGTGGCTGGAAACCAGTCCCAATTCCTAGTCTTGAGGATGTCTGCATCACTCAGATAG CTTGTGGTGGATATCATTCACTTGCATTAACTGATGAAGGTAAGGTCCTTTCATGGGGTTTCGGTGGGCATGGGCAGCTTGGTCATTCATCATCCATGGA AAACCAGAAAATCCCAGTAGTTATTGATGCCTTGGCTGATCAGAATGTCGTCCATATTGCTTGTGGAGGCTCTACTTCAGCGGCTATAACTGAGGAAGGG AAGCTTTATATGTGGGGAAATAACAGAGATTTTCAGTTGGGAGTTGCTGGCTTACCTGAGGCCCAACCACTTCCTGTTGAGGTGAAGTTTCTGATGGAAG ACAATGGTTTGGAACCTCACAAGTTACTCTCTGTCTCTGTTGGGGCTTCTCATGTTATGTGTTTGGCATTAAGGTCCGGTTTCTGA
AA sequence Show only first row Show all	>Lus10008599 pacid=23180107 polypeptide=Lus10008599 locus=Lus10008599.g ID=Lus10008599.BGIv1.0 annot-version=v1.0 MANSNYELGRGNKVGGWKPVPIPSLEDVCITQIACGGYHSLALTDEGKVLSWGFGGHGQLGHSSSMENQKIPVVIDALADQNVVHIACGGSTSAAITEEG KLYMWGNNRDFQLGVAGLPEAQPLPVEVKFLMEDNGLEPHKLLSVSVGASHVMCLALRSGF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G60870		RUG3	RCC1/UVR8/GEF-like 3, Regulato...		Lus10008599 [exp]	0	1
AT2G39550		GGB, ATGGT-IB, ...	GERANYLGERANYLTRANSFERASE-I BE...		Lus10000944 [exp]	4.9	0.8068
AT3G02250			O-fucosyltransferase family pr...		Lus10036833 [exp]	58.2	0.7610
AT1G66590		ATCOX19-1	A. THALIANA CYTOCHROME C OXIDA...		Lus10025812 [exp]	70.7	0.7286
AT5G58030			Transport protein particle (TR...		Lus10036292 [exp]	91.9	0.7052
AT1G53600			Tetratricopeptide repeat (TPR)...		Lus10042207 [exp]	100.3	0.7525
AT3G46220			unknown protein		Lus10000127 [exp]	106.0	0.7379

Compare expression of checked genes

Lus10008599 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.