Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G60870 267 / 7e-87 RUG3 RCC1/UVR8/GEF-like 3, Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2), Regulator of chromosome condensation (RCC1) family protein (.3) AT3G02510 74 / 1e-14 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2) AT3G02300 74 / 2e-14 Regulator of chromosome condensation (RCC1) family protein (.1) AT5G16040 72 / 4e-14 Regulator of chromosome condensation (RCC1) family protein (.1) AT1G65920 72 / 1e-13 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) AT5G48330 69 / 5e-13 RUG2 RCC1/UVR8/GEF-like 2, Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2) AT5G63860 69 / 5e-13 UVR8 UVB-RESISTANCE 8, Regulator of chromosome condensation (RCC1) family protein (.1) AT5G12350 69 / 1e-12 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) AT5G19420 68 / 2e-12 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) AT3G03790 64 / 5e-11 ankyrin repeat family protein / regulator of chromosome condensation (RCC1) family protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042215 [exp] 490 / 3e-174 AT5G60870 547 / 0.0 RCC1/UVR8/GEF-like 3, Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2), Regulator of chromosome condensation (RCC1) family protein (.3) Lus10013197 [exp] 78 / 8e-16 AT3G02300 711 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1) Lus10030712 [exp] 78 / 1e-15 AT3G02300 717 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1) Lus10017581 [exp] 76 / 5e-15 AT3G02510 636 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2) Lus10033543 [exp] 76 / 5e-15 AT3G02510 648 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2) Lus10008599 [exp] 72 / 6e-15 AT5G60870 231 / 2e-77 RCC1/UVR8/GEF-like 3, Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2), Regulator of chromosome condensation (RCC1) family protein (.3) Lus10039525 [exp] 72 / 9e-14 AT5G19420 1245 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Lus10037192 [exp] 71 / 2e-13 AT1G69710 986 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) Lus10024157 [exp] 71 / 2e-13 AT5G19420 1279 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G000600 [exp] 322 / 5e-108 AT5G60870 534 / 0.0 RCC1/UVR8/GEF-like 3, Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2), Regulator of chromosome condensation (RCC1) family protein (.3) Potri.017G099900 [exp] 77 / 1e-15 AT3G02300 711 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1) Potri.007G100200 [exp] 75 / 8e-15 AT5G63860 738 / 0.0 UVB-RESISTANCE 8, Regulator of chromosome condensation (RCC1) family protein (.1) Potri.004G101800 [exp] 74 / 8e-15 AT5G16040 665 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1) Potri.001G276900 [exp] 75 / 1e-14 AT5G19420 1483 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Potri.009G071800 [exp] 74 / 2e-14 AT5G19420 1610 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Potri.017G113200 [exp] 71 / 1e-13 AT5G16040 676 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1) Potri.017G139600 [exp] 70 / 4e-13 AT1G65920 937 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) Potri.004G080900 [exp] 69 / 1e-12 AT1G65920 940 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) Potri.002G070300 [exp] 68 / 2e-12 AT5G42140 1422 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0186 [flax] [poplar] Beta_propeller PF00415 [flax] [poplar] RCC1 Regulator of chromosome condensation (RCC1) repeat
Representative CDS sequence Show only first row Show all	>Lus10008601 pacid=23180097 polypeptide=Lus10008601 locus=Lus10008601.g ID=Lus10008601.BGIv1.0 annot-version=v1.0 ATGATGTGTTTGCACCGTCAATGGCGTACTTTTTGTTCTAAGCCTCACATATCTTCCTGTTCCACTTTTCTTAGAAGCATCCATGAGGTTCCCATTCTAT ACAAAAGCCCAAAACTCAGCAATGAAAATGAAAACCAGGGCAAAACTCTACAACTTCTGTCCTGGGGAAGAGGTGCCTCTGGCCAGCTTGGTGGTGGCAA TGAAGAAACCCGACTCTACCCTGCTGCTGCTGCAAACCTTTATGTCCTTAGTTCCTCCTTCACTTTTTCTCCAACCCCGGGACAGTTGCTTAAGTCTACG CTCAATAACCAAAACAACCTTAAGCAGAAGACTGAAATTGGCATTTCCTGTGGGTTATTCCATTCAGCTTTACTTGTGGATGGTAAGATTTGGATTTGGG GTAAAGGCGATGGTGGCCGTCTTGGCCTCGGGCACGAGAACATCGCTTTTGTTCCTACTGTTAACCCTTACTTGGATGACATTCGCTGCATTGCTTTGGG TGGAGTTCATTCGGTTGCGCTCACTTCCTCAGGTCAAATATTTACATGGGGCTATGGTGGTTTTGGTGCACTTGGACATTCTGTTTATCATCGAGAGTTA TTGCCCAGGTTGGTAGAAGGTATTTCGAATGTGAAAATGTCCTCTATCGCAACCAGTGGAACACATACTGCTGCTGTCACCGAGACAGGTGAGCTTTATA CATGGGGTCGTGATGAAGGGGATGGTAGACTGGGGCTTGGTCCTGGTCGGGGTCACAATGAAGCAGGTGGACTAAGCATCCCTTCCAAAGTTAGAGGTTT GCCTGTTCCAGTTTCTGCTGTTTGTTGTGGTGGGTTCTTCACAATGGCGCTCACACAGGATGGGAAAATATGGAATTGGGGTGTCAGGCATGATTCAAGT TTTGTCTTAGACATTTCTTGGGATATTTGA
AA sequence Show only first row Show all	>Lus10008601 pacid=23180097 polypeptide=Lus10008601 locus=Lus10008601.g ID=Lus10008601.BGIv1.0 annot-version=v1.0 MMCLHRQWRTFCSKPHISSCSTFLRSIHEVPILYKSPKLSNENENQGKTLQLLSWGRGASGQLGGGNEETRLYPAAAANLYVLSSSFTFSPTPGQLLKST LNNQNNLKQKTEIGISCGLFHSALLVDGKIWIWGKGDGGRLGLGHENIAFVPTVNPYLDDIRCIALGGVHSVALTSSGQIFTWGYGGFGALGHSVYHREL LPRLVEGISNVKMSSIATSGTHTAAVTETGELYTWGRDEGDGRLGLGPGRGHNEAGGLSIPSKVRGLPVPVSAVCCGGFFTMALTQDGKIWNWGVRHDSS FVLDISWDI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G60870		RUG3	RCC1/UVR8/GEF-like 3, Regulato...		Lus10008601 [exp]	0	1
AT4G10320			tRNA synthetase class I (I, L,...		Lus10024041 [exp]	7.2	0.8845
AT4G11420		ATTIF3A1, ATEIF...	eukaryotic translation initiat...		Lus10015202 [exp]	16.1	0.8727
AT1G12700		RPF1	RNA processing factor 1, ATP b...		Lus10003433 [exp]	27.4	0.8091
AT4G03090			sequence-specific DNA binding;...		Lus10006938 [exp]	28.2	0.8684
AT1G27590			unknown protein		Lus10028228 [exp]	30.3	0.8517
AT5G15270			RNA-binding KH domain-containi...		Lus10030689 [exp]	33.2	0.8254
AT1G27590			unknown protein		Lus10007229 [exp]	36.1	0.8468
AT3G14120			unknown protein		Lus10037684 [exp]	38.6	0.8467
AT2G31660		EMA1, URM9, SAD...	UNARMED 9, SUPER SENSITIVE TO ...		Lus10026726 [exp]	39.9	0.8403
AT4G38350			Patched family protein (.1.2)		Lus10016019 [exp]	45.3	0.7544

Compare expression of checked genes

Lus10008601 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.