Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G12000 155 / 2e-45 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT5G26150 150 / 1e-43 protein kinase family protein (.1) AT4G31230 150 / 2e-43 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT2G24370 150 / 2e-43 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT2G07020 149 / 2e-43 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT1G16760 149 / 5e-43 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT1G78940 147 / 9e-43 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1.2) AT5G35380 145 / 6e-42 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT3G20200 140 / 3e-40 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT1G17540 138 / 2e-39 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042205 [exp] 191 / 2e-58 AT1G16760 691 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10024212 [exp] 173 / 8e-52 AT2G24370 780 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10021596 [exp] 161 / 1e-47 AT2G24370 828 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10040573 [exp] 161 / 1e-47 AT2G24370 815 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10027593 [exp] 157 / 4e-47 AT2G24370 665 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10008542 [exp] 157 / 5e-46 AT2G24370 823 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10020185 [exp] 155 / 5e-46 AT2G24370 741 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10026989 [exp] 154 / 1e-44 AT2G24370 1014 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10026439 [exp] 149 / 1e-43 AT5G12000 662 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G170943 [exp] 149 / 2e-47 AT1G78940 208 / 1e-63 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1.2) Potri.006G078500 [exp] 159 / 1e-46 AT2G24370 824 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Potri.007G001900 [exp] 158 / 2e-46 AT1G78940 757 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1.2) Potri.018G002400 [exp] 157 / 3e-46 AT2G24370 956 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Potri.018G061600 [exp] 154 / 4e-45 AT5G12000 714 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Potri.004G170742 [exp] 149 / 2e-43 AT1G78940 786 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1.2) Potri.014G001700 [exp] 149 / 4e-43 AT1G78940 783 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1.2) Potri.006G225300 [exp] 149 / 5e-43 AT5G12000 749 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Potri.001G198300 [exp] 145 / 6e-42 AT5G12000 639 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Potri.004G233000 [exp] 105 / 7e-28 AT4G25160 874 / 0.0 U-box domain-containing protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [flax] [poplar] PKinase PF00069 [flax] [poplar] Pkinase Protein kinase domain
Representative CDS sequence Show only first row Show all	>Lus10008610 pacid=23180085 polypeptide=Lus10008610 locus=Lus10008610.g ID=Lus10008610.BGIv1.0 annot-version=v1.0 ATGACTCAGACCGCCGGAACATTCTGCTACATCGATCCCGAGTATCAGCAGACAGGAATGCTGGGGACCAAATCGGACATCTACTCGCTGGGAATCATTC TCTTACAACTGCTCACAGCCAAGCCTCCGATGGGGCTGACTCACCACGTGTCTAGAGCGATCAAGAAGGGGGAGTTCCCCAGCGTGTTGGATCCCGATGT GCCCGATTGGCCTTTGGAGGAGGCGCTGCGTTTGGCGAAATTAGCGATTCGGTGTGCGGAGCTGAGGAAGAAGGATAGGCCGGATCTGAACGACGTCGTG TTGCCGGTAGTATGA
AA sequence Show only first row Show all	>Lus10008610 pacid=23180085 polypeptide=Lus10008610 locus=Lus10008610.g ID=Lus10008610.BGIv1.0 annot-version=v1.0 MTQTAGTFCYIDPEYQQTGMLGTKSDIYSLGIILLQLLTAKPPMGLTHHVSRAIKKGEFPSVLDPDVPDWPLEEALRLAKLAIRCAELRKKDRPDLNDVV LPVV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G24370			Protein kinase protein with ad...		Lus10008610 [exp]	0	1
AT1G16760			Protein kinase protein with ad...		Lus10008609 [exp]	1.0	0.9108
AT4G15390			HXXXD-type acyl-transferase fa...		Lus10036042 [exp]	3.9	0.8098
AT1G54120			unknown protein		Lus10008114 [exp]	8.1	0.8138
AT3G01680		SEOR1, SEOb	Sieve-Element-Occlusion-Relate...		Lus10017777 [exp]	12.2	0.7406
AT5G05460		AtENGase85A	Endo-beta-N-acetyglucosaminida...		Lus10017430 [exp]	13.9	0.8064
AT1G11940			Core-2/I-branching beta-1,6-N-...		Lus10020037 [exp]	36.9	0.7357
					Lus10040471 [exp]	37.4	0.6662
AT3G26040			HXXXD-type acyl-transferase fa...		Lus10012759 [exp]	38.3	0.7348
AT5G45800		MEE62	maternal effect embryo arrest ...		Lus10029235 [exp]	47.3	0.7251
AT3G26040			HXXXD-type acyl-transferase fa...		Lus10000319 [exp]	47.4	0.6992

Compare expression of checked genes

Lus10008610 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.