Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G74670 132 / 2e-41 GASA6 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) AT5G15230 115 / 6e-35 GASA4 GAST1 protein homolog 4 (.1.2) AT3G10185 84 / 1e-22 Gibberellin-regulated family protein (.1) AT2G30810 82 / 2e-21 Gibberellin-regulated family protein (.1) AT3G02885 79 / 1e-20 GASA5 GAST1 protein homolog 5 (.1) AT2G39540 70 / 3e-17 Gibberellin-regulated family protein (.1) AT1G10588 68 / 3e-16 Gibberellin-regulated family protein (.1.2) AT5G59845 65 / 4e-15 Gibberellin-regulated family protein (.1) AT1G22690 65 / 1e-14 Gibberellin-regulated family protein (.1.2.3) AT4G09600 63 / 4e-14 GASA3 GAST1 protein homolog 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042203 [exp] 165 / 2e-54 AT1G74670 138 / 6e-44 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10002059 [exp] 156 / 4e-51 AT1G74670 132 / 1e-41 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10030680 [exp] 122 / 1e-37 AT5G15230 131 / 5e-41 GAST1 protein homolog 4 (.1.2) Lus10024216 [exp] 118 / 2e-35 AT1G74670 106 / 1e-30 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10018016 [exp] 104 / 3e-30 AT1G74670 110 / 2e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10029340 [exp] 102 / 1e-29 AT2G30810 108 / 3e-32 Gibberellin-regulated family protein (.1) Lus10005241 [exp] 100 / 5e-29 ND 96 / 4e-27 Lus10004048 [exp] 95 / 9e-27 AT1G74670 109 / 1e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10042012 [exp] 93 / 8e-26 AT1G74670 96 / 6e-27 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G083000 [exp] 114 / 2e-34 AT5G15230 116 / 3e-35 GAST1 protein homolog 4 (.1.2) Potri.001G254100 [exp] 108 / 5e-32 AT1G74670 111 / 4e-33 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Potri.006G044400 [exp] 101 / 3e-29 AT1G74670 108 / 9e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Potri.017G124200 [exp] 94 / 1e-26 AT3G02885 101 / 1e-29 GAST1 protein homolog 5 (.1) Potri.001G315500 [exp] 84 / 1e-22 AT2G30810 91 / 5e-25 Gibberellin-regulated family protein (.1) Potri.014G020100 [exp] 65 / 4e-15 AT5G59845 99 / 9e-29 Gibberellin-regulated family protein (.1) Potri.019G083900 [exp] 63 / 3e-14 AT1G22690 103 / 1e-29 Gibberellin-regulated family protein (.1.2.3) Potri.013G113400 [exp] 62 / 9e-14 AT2G18420 96 / 2e-27 Gibberellin-regulated family protein (.1) Potri.009G092600 [exp] 61 / 2e-13 AT2G14900 99 / 2e-28 Gibberellin-regulated family protein (.1) Potri.001G297700 [exp] 60 / 4e-13 AT2G14900 96 / 2e-27 Gibberellin-regulated family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02704 [flax] [poplar] GASA Gibberellin regulated protein
Representative CDS sequence Show only first row Show all	>Lus10008612 pacid=23180059 polypeptide=Lus10008612 locus=Lus10008612.g ID=Lus10008612.BGIv1.0 annot-version=v1.0 ATGGCAATGGCTGCTAAGCAACTCCTCTGTCTATTGATCCTCGCCATTCTCGGCCTCTCCATGGTCGCCACTGAGGTCATGGCTAGGGGGAAGGGGGGGA ACTTTGGACCTGGAAGTCTGAAGAGCTACCAATGCGGGGGGCAATGCACGAGGAGATGCAGCAGGACGCAATACAGGAAGCCATGTTTGTTCTTCTGCAA CAAATGCTGCGCAAAGTGTCTGTGTGTCCCTCCTGGCTTCTACGGCAACAAGGCAGTTTGCCCTTGCTACAACAACTGGAAGACCCAGCAAGGAGGCCCC AAATGCCCTTAG
AA sequence Show only first row Show all	>Lus10008612 pacid=23180059 polypeptide=Lus10008612 locus=Lus10008612.g ID=Lus10008612.BGIv1.0 annot-version=v1.0 MAMAAKQLLCLLILAILGLSMVATEVMARGKGGNFGPGSLKSYQCGGQCTRRCSRTQYRKPCLFFCNKCCAKCLCVPPGFYGNKAVCPCYNNWKTQQGGP KCP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G74670		GASA6	GA-stimulated Arabidopsis 6, G...		Lus10008612 [exp]	0	1
AT5G42030		ABIL4	ABL interactor-like protein 4 ...		Lus10034928 [exp]	2.0	0.8464
AT2G32580			Protein of unknown function (D...		Lus10029975 [exp]	2.2	0.8428
AT2G40610		ATHEXPALPHA1.11...	expansin A8 (.1)		Lus10034227 [exp]	2.6	0.8630
AT1G75710	C2H2ZnF		C2H2-like zinc finger protein ...		Lus10034522 [exp]	4.2	0.8570
AT1G53700		PK3AT, WAG1	PROTEIN KINASE 3 ARABIDOPSIS T...		Lus10005583 [exp]	9.2	0.8163
AT3G49050			alpha/beta-Hydrolases superfam...		Lus10039240 [exp]	11.2	0.8049
AT2G37640		ATHEXPALPHA1.9,...	ARABIDOPSIS THALIANA EXPANSIN ...		Lus10024388 [exp]	12.8	0.8533
AT1G76890	Trihelix	AT-GT2, GT2	Duplicated homeodomain-like su...		Lus10029778 [exp]	13.4	0.7976
AT5G50335			unknown protein		Lus10008207 [exp]	13.7	0.8113
AT3G43720			Bifunctional inhibitor/lipid-t...		Lus10001153 [exp]	14.1	0.8320

Compare expression of checked genes

Lus10008612 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.