Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G48820 56 / 2e-10 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) AT4G13300 55 / 2e-10 ATTPS13, TPS13 terpenoid synthase 13 (.1) AT1G33750 54 / 4e-10 AtTPS22 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) AT4G13280 54 / 4e-10 ATTPS12, TPS12 terpenoid synthase 12 (.1) AT5G23960 53 / 1e-09 ATTPS21 terpene synthase 21 (.1.2) AT3G14520 52 / 2e-09 AtTPS18 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) AT3G14540 52 / 2e-09 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) AT3G14490 52 / 4e-09 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) AT2G23230 51 / 5e-09 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) AT4G16740 50 / 1e-08 ATTPS03 terpene synthase 03 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008614 [exp] 119 / 4e-33 AT5G23960 345 / 1e-112 terpene synthase 21 (.1.2) Lus10008611 [exp] 105 / 3e-28 AT5G23960 348 / 4e-113 terpene synthase 21 (.1.2) Lus10042204 [exp] 102 / 3e-27 AT5G23960 347 / 4e-113 terpene synthase 21 (.1.2) Lus10002660 [exp] 76 / 1e-17 AT3G14520 310 / 4e-98 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) Lus10040043 [exp] 73 / 1e-16 AT5G23960 329 / 7e-106 terpene synthase 21 (.1.2) Lus10014724 [exp] 67 / 2e-14 AT5G23960 314 / 2e-100 terpene synthase 21 (.1.2) Lus10001110 [exp] 60 / 6e-12 AT3G25810 362 / 1e-118 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) Lus10031590 [exp] 54 / 8e-10 AT5G23960 378 / 3e-125 terpene synthase 21 (.1.2) Lus10018501 [exp] 49 / 3e-08 AT4G16740 413 / 1e-137 terpene synthase 03 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G130666 [exp] 65 / 7e-14 AT5G23960 220 / 4e-66 terpene synthase 21 (.1.2) Potri.005G095500 [exp] 64 / 1e-13 AT5G23960 408 / 6e-137 terpene synthase 21 (.1.2) Potri.019G045100 [exp] 57 / 6e-11 AT5G23960 474 / 2e-162 terpene synthase 21 (.1.2) Potri.019G045400 [exp] 56 / 1e-10 AT5G23960 368 / 8e-123 terpene synthase 21 (.1.2) Potri.019G016122 [exp] 55 / 3e-10 AT5G23960 426 / 7e-144 terpene synthase 21 (.1.2) Potri.019G016700 [exp] 55 / 3e-10 AT5G23960 482 / 6e-166 terpene synthase 21 (.1.2) Potri.019G020367 [exp] 54 / 4e-10 AT5G23960 494 / 7e-171 terpene synthase 21 (.1.2) Potri.011G142800 [exp] 54 / 5e-10 AT5G23960 405 / 2e-135 terpene synthase 21 (.1.2) Potri.001G308200 [exp] 54 / 5e-10 AT3G25810 499 / 4e-171 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) Potri.019G023008 [exp] 54 / 5e-10 AT3G25830 535 / 0.0 "terpene synthase-like sequence-1,8-cineole", terpene synthase-like sequence-1,8-cineole (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01397 [flax] [poplar] Terpene_synth Terpene synthase, N-terminal domain
Representative CDS sequence Show only first row Show all	>Lus10008613 pacid=23180063 polypeptide=Lus10008613 locus=Lus10008613.g ID=Lus10008613.BGIv1.0 annot-version=v1.0 ATGACGGAAGAAGGAAAGTTCCAGAGAGAACTAGCAAAGGACATAGAAGGAATGTTAAGCTTGTACGAAGCTGGATACATGAGGAAGCAAGGAGAGAGTA TATTAGACGAAGCAATTCAGTTCACAAAGTCACACCTCAACTCTGCAATATTAATGGCGACGAAAGAATTAGATTCTTCAGTACTAACTAATCGAATCAG TCATGCATTGGAAAGGCCACCTTCGCAAAGGAGTGGCCAAGGTTGA
AA sequence Show only first row Show all	>Lus10008613 pacid=23180063 polypeptide=Lus10008613 locus=Lus10008613.g ID=Lus10008613.BGIv1.0 annot-version=v1.0 MTEEGKFQRELAKDIEGMLSLYEAGYMRKQGESILDEAIQFTKSHLNSAILMATKELDSSVLTNRISHALERPPSQRSGQG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G48820			Terpenoid cyclases/Protein pre...		Lus10008613 [exp]	0	1
AT1G31720			Protein of unknown function (D...		Lus10034746 [exp]	1.4	0.9392
AT2G15220			Plant basic secretory protein ...		Lus10019804 [exp]	2.0	0.9106
AT5G43500		ATARP9	actin-related protein 9 (.1.2)		Lus10021206 [exp]	3.9	0.8875
AT3G19950			RING/U-box superfamily protein...		Lus10033682 [exp]	6.0	0.8397
AT5G46030			unknown protein		Lus10014995 [exp]	10.0	0.8543
AT5G13530		KEG	KEEP ON GOING, protein kinases...		Lus10020272 [exp]	11.5	0.8374
AT5G42510			Disease resistance-responsive ...		Lus10000376 [exp]	13.7	0.7818
AT2G43570		CHI	"chitinase, putative", chitina...		Lus10014253 [exp]	14.6	0.7140
AT3G11660		NHL1	NDR1/HIN1-like 1 (.1)		Lus10013327 [exp]	17.7	0.8350
AT1G20510		OPCL1	OPC-8:0 CoA ligase1 (.1.2)		Lus10015815 [exp]	20.0	0.6804

Compare expression of checked genes

Lus10008613 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.