Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G08685 160 / 9e-51 SAH7 Pollen Ole e 1 allergen and extensin family protein (.1) AT1G78040 127 / 1e-37 Pollen Ole e 1 allergen and extensin family protein (.1.2) AT5G10130 104 / 5e-29 Pollen Ole e 1 allergen and extensin family protein (.1) AT4G18596 82 / 6e-20 Pollen Ole e 1 allergen and extensin family protein (.1) AT1G29140 81 / 1e-19 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G45880 80 / 2e-19 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G41050 40 / 0.0002 Pollen Ole e 1 allergen and extensin family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042201 [exp] 291 / 2e-102 AT4G08685 171 / 3e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10041707 [exp] 137 / 1e-41 AT5G10130 150 / 9e-47 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10026040 [exp] 134 / 1e-40 AT5G10130 159 / 3e-50 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10014332 [exp] 127 / 1e-37 AT5G10130 154 / 2e-48 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10013681 [exp] 107 / 9e-30 AT1G29140 117 / 6e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10017940 [exp] 106 / 2e-29 AT1G29140 117 / 8e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10018131 [exp] 103 / 2e-28 AT1G29140 118 / 5e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10028134 [exp] 100 / 4e-27 AT1G29140 118 / 4e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10042838 [exp] 98 / 3e-26 AT1G29140 115 / 6e-33 Pollen Ole e 1 allergen and extensin family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G167900 [exp] 182 / 2e-59 AT4G08685 171 / 3e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.002G093100 [exp] 178 / 4e-58 AT4G08685 199 / 3e-66 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.007G090100 [exp] 130 / 4e-39 AT4G08685 152 / 1e-47 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.005G078200 [exp] 129 / 6e-39 AT4G08685 165 / 5e-53 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.011G111300 [exp] 116 / 1e-33 AT1G29140 148 / 4e-46 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.001G392400 [exp] 101 / 1e-27 AT1G29140 137 / 1e-41 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.001G060500 [exp] 47 / 2e-06 AT5G13140 185 / 3e-57 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.003G167100 [exp] 46 / 3e-06 AT5G13140 180 / 2e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.001G326200 [exp] 44 / 6e-06 AT5G41050 158 / 9e-50 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.017G068400 [exp] 41 / 0.0001 AT5G41050 172 / 3e-55 Pollen Ole e 1 allergen and extensin family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0287 [flax] [poplar] Transthyretin PF01190 [flax] [poplar] Pollen_Ole_e_1 Pollen protein Ole e 1 like
Representative CDS sequence Show only first row Show all	>Lus10008615 pacid=23180052 polypeptide=Lus10008615 locus=Lus10008615.g ID=Lus10008615.BGIv1.0 annot-version=v1.0 ATGGCTCCTCGATTCTTGCTCTTCGTTGCTCTCTCCGTCCTCCTCGCCGCTCTCGTCTCCGATGCCCGCCCTGCTAAGGACCCGTTCCTCGTCCGCGGCA AGGTCTACTGCGACACCTGCAACTTCGGCTTCGAAACCCCCAAATCCACTTCCATTCCTGGTGCTACGGTGAAGATTCAGTGCAGGAGCAGGAAATCCAA CGAGCTGGTTTACGAGAGGGAAGGGACGACTAACTCGGAAGGGATGTACGAGATCCACGTGGACGAAGACCACATGGACCAAGTGTGCGATGCTAAGGTG GTCAACAGCCCGCAGCTCGACTGCTTCAAGCCGTCTGCAGGACGGGATCAGGCTCGCGTTATCCTGACCGATTCGAACGGCATGTCAAGCAAGGTTCGGT TTGCGAATGCCATGGGGTACTCCAAGGAAGGAACTGTGGATGGTTGCTCCCAGCTTCTCAGCCTTTACCAGGAGAATGATGATTAG
AA sequence Show only first row Show all	>Lus10008615 pacid=23180052 polypeptide=Lus10008615 locus=Lus10008615.g ID=Lus10008615.BGIv1.0 annot-version=v1.0 MAPRFLLFVALSVLLAALVSDARPAKDPFLVRGKVYCDTCNFGFETPKSTSIPGATVKIQCRSRKSNELVYEREGTTNSEGMYEIHVDEDHMDQVCDAKV VNSPQLDCFKPSAGRDQARVILTDSNGMSSKVRFANAMGYSKEGTVDGCSQLLSLYQENDD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G08685		SAH7	Pollen Ole e 1 allergen and ex...		Lus10008615 [exp]	0	1
AT5G52060		ATBAG1	BCL-2-associated athanogene 1 ...		Lus10027420 [exp]	1.0	0.8993
AT1G64980			Nucleotide-diphospho-sugar tra...		Lus10005005 [exp]	2.0	0.8758
AT4G12420		SKU5	Cupredoxin superfamily protein...		Lus10028921 [exp]	2.4	0.8876
AT3G23820		GAE6	UDP-D-glucuronate 4-epimerase ...		Lus10016640 [exp]	3.7	0.8888
AT2G31440			unknown protein		Lus10025574 [exp]	6.6	0.8578
AT4G33625			unknown protein		Lus10020442 [exp]	7.2	0.8399
AT5G01710			methyltransferases (.1)		Lus10012217 [exp]	7.7	0.8729
AT1G07410		ATRAB-A2B, AtRA...	ARABIDOPSIS RAB GTPASE HOMOLOG...		Lus10040745 [exp]	8.8	0.8515
					Lus10026314 [exp]	9.5	0.8596
AT1G12840		ATVHA-C, DET3	DE-ETIOLATED 3, ARABIDOPSIS TH...		Lus10031990 [exp]	9.9	0.8293

Compare expression of checked genes

Lus10008615 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.