Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G26880 180 / 4e-60 Ribosomal protein L34e superfamily protein (.1.2) AT1G69620 177 / 5e-59 RPL34 ribosomal protein L34 (.1) AT3G28900 174 / 8e-58 Ribosomal protein L34e superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042199 [exp] 189 / 2e-63 AT1G26880 217 / 8e-75 Ribosomal protein L34e superfamily protein (.1.2) Lus10037177 [exp] 188 / 3e-63 AT1G26880 219 / 2e-75 Ribosomal protein L34e superfamily protein (.1.2) Lus10012829 [exp] 188 / 3e-63 AT1G26880 219 / 2e-75 Ribosomal protein L34e superfamily protein (.1.2) Lus10030477 [exp] 188 / 3e-63 AT1G26880 219 / 2e-75 Ribosomal protein L34e superfamily protein (.1.2) Lus10036750 [exp] 187 / 1e-62 AT1G26880 217 / 8e-75 Ribosomal protein L34e superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G082200 [exp] 184 / 1e-61 AT1G26880 187 / 7e-63 Ribosomal protein L34e superfamily protein (.1.2) Potri.012G108400 [exp] 184 / 2e-61 AT1G26880 187 / 7e-63 Ribosomal protein L34e superfamily protein (.1.2) Potri.015G106466 [exp] 183 / 2e-61 AT1G26880 187 / 1e-62 Ribosomal protein L34e superfamily protein (.1.2) Potri.015G106532 [exp] 183 / 2e-61 AT1G26880 187 / 1e-62 Ribosomal protein L34e superfamily protein (.1.2) Potri.001G195101 [exp] 175 / 5e-58 AT1G26880 178 / 3e-59 Ribosomal protein L34e superfamily protein (.1.2) Potri.004G029400 [exp] 162 / 1e-52 AT1G26880 168 / 6e-55 Ribosomal protein L34e superfamily protein (.1.2) Potri.012G108301 [exp] 105 / 8e-31 AT1G26880 105 / 3e-31 Ribosomal protein L34e superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01199 [flax] [poplar] Ribosomal_L34e Ribosomal protein L34e
Representative CDS sequence Show only first row Show all	>Lus10008617 pacid=23180120 polypeptide=Lus10008617 locus=Lus10008617.g ID=Lus10008617.BGIv1.0 annot-version=v1.0 ATGGTGCAGCGACTCACTTACCGTAAGCGCCATAGCTACGCCACCAAGTCCAATCAGCACCGCATCGTCAAGACTCCAGGTGGTAAGCTTGTGTACCAGA CACCCAAGAAGCGAGCCAGTGGACCTAAATGTCCAGTTACTGGAAAGAGGATTCAAGGGATTCCACACTTGAGGCCTGCTGAATACAAGAGATCTAGGCT ACCGAGGAACAGGAGGACAGTGAACCGTGCTTACGGTGGTGTCTTATCTGGAGGGGCTGTAAGGGAGAGGATCATTAGAGCATTTTTGGTTGAAGAGCAA AAGATTGTGAAGAAGGTGCTCAAGATTCAGAAGTCAAAGGAAAAGACCACAAAGGCCTAG
AA sequence Show only first row Show all	>Lus10008617 pacid=23180120 polypeptide=Lus10008617 locus=Lus10008617.g ID=Lus10008617.BGIv1.0 annot-version=v1.0 MVQRLTYRKRHSYATKSNQHRIVKTPGGKLVYQTPKKRASGPKCPVTGKRIQGIPHLRPAEYKRSRLPRNRRTVNRAYGGVLSGGAVRERIIRAFLVEEQ KIVKKVLKIQKSKEKTTKA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G26880			Ribosomal protein L34e superfa...		Lus10008617 [exp]	0	1
AT1G34030			Ribosomal protein S13/S18 fami...		Lus10034179 [exp]	3.2	0.8988
AT3G23620			Ribosomal RNA processing Brix ...		Lus10035575 [exp]	4.6	0.8836
AT2G36620		RPL24A	ribosomal protein L24 (.1)		Lus10006314 [exp]	6.5	0.8912
AT1G80560		ATIMD2	ARABIDOPSIS ISOPROPYLMALATE DE...		Lus10041077 [exp]	7.3	0.8317
AT5G62300			Ribosomal protein S10p/S20e fa...		Lus10027194 [exp]	9.2	0.8467
AT3G45030			Ribosomal protein S10p/S20e fa...		Lus10031706 [exp]	13.0	0.8525
AT3G25520		PGY3, ATL5, OLI...	RIBOSOMAL PROTEIN L5 A, PIGGYB...		Lus10020612 [exp]	14.8	0.8537
AT1G26880			Ribosomal protein L34e superfa...		Lus10030477 [exp]	18.2	0.8774
AT1G26880			Ribosomal protein L34e superfa...		Lus10012829 [exp]	19.9	0.8677
AT5G40080			Mitochondrial ribosomal protei...		Lus10011032 [exp]	20.4	0.8607

Compare expression of checked genes

Lus10008617 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.