Lus10008625 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G47670 129 / 2e-36 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G53840 99 / 1e-23 ATPME1 pectin methylesterase 1 (.1)
AT3G14300 83 / 6e-18 ATPMEPCRC, ATPME26 A. THALIANA PECTIN METHYLESTERASE 26, pectinesterase family protein (.1)
AT2G01610 75 / 4e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G14890 74 / 7e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G23205 73 / 2e-15 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT4G25250 72 / 4e-15 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G70720 69 / 6e-14 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G62360 66 / 6e-13 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G62770 63 / 7e-12 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042193 395 / 5e-135 AT5G39850 327 / 2e-108 Ribosomal protein S4 (.1)
Lus10037457 104 / 2e-26 AT1G53840 234 / 1e-72 pectin methylesterase 1 (.1)
Lus10003934 105 / 8e-26 AT3G14300 663 / 0.0 A. THALIANA PECTIN METHYLESTERASE 26, pectinesterase family protein (.1)
Lus10031711 81 / 1e-18 AT5G62360 145 / 4e-44 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10038645 81 / 2e-18 AT2G01610 212 / 2e-69 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031138 77 / 4e-17 AT5G62360 172 / 3e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031132 77 / 4e-17 AT1G62760 135 / 3e-40 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10037458 70 / 1e-13 AT3G14310 491 / 2e-170 pectin methylesterase 3 (.1)
Lus10038915 66 / 5e-13 AT5G62360 174 / 5e-55 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G123500 144 / 2e-42 AT3G47670 141 / 8e-41 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.001G108200 140 / 5e-41 AT3G47670 122 / 1e-33 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.003G072700 108 / 6e-27 AT1G53840 723 / 0.0 pectin methylesterase 1 (.1)
Potri.001G162700 101 / 2e-24 AT1G53840 659 / 0.0 pectin methylesterase 1 (.1)
Potri.015G128200 77 / 5e-17 AT5G62360 172 / 1e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128300 76 / 9e-17 AT5G62360 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.008G132600 75 / 3e-16 AT1G14890 216 / 1e-71 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.010G109300 75 / 3e-16 AT1G14890 218 / 5e-72 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.006G134700 76 / 8e-16 AT4G33230 608 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.018G051200 74 / 4e-15 AT2G26450 634 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10008625 pacid=23180094 polypeptide=Lus10008625 locus=Lus10008625.g ID=Lus10008625.BGIv1.0 annot-version=v1.0
ATGGAATCAATCAACTTCGCCAAGGGCTACGGCAGAGTAAGCACATCAACTCATCTTCAACCCCAAGATCAACCTCCTCATCGCCCAACCAAATCCATCA
GAAAACCCCTAACCGCAGTAGCCTCCGCCGTCATCATCCTCCTCATCGTGCTCCTCGCCGTCCACAACCACAACAGCAGCAACGAATCCCTAAAGAAGCC
GGAACAACATCTCCCTCCCTCCGCCTCCGTCGCCGATTCAATCAGATTCGTCTGTAACGTCACCCGCTATCCAAACCCCTGCTTCACCGCCATATCCTCA
GCTATGGACTCGAGCTCCGCTTCCGATCCGGAAGCGATCCTTAAAGTCTCGATCCGAGTCTCCCTCACTAGGATCTCGGATCTGGCTTCCTTGTTTCGGA
ACTCTTCCTCCTCGAAGTCGCCGGCTGTGGACGACTGCGTTGACCAGCTGGATGAGGCGAAGAGCAATCTGAAGCAGTCGATTGCGGCTATGGAGGAGAA
GGCGTTGACGGAGGAGAAGATCGCCGACTTGAAGACGTGGATAAGCGCAGCGATGACCGACGAGGAGACTTGCCGGGACGGGATGGAGGAAATGGGGGCG
ACGGTGGCGGAAGGAATGAAGGCGGAGATGGAGGATTGTACGGAGATGATGAGTAATAGCTTGGCGATCCTCGCTAATTTGCCTTCATTGCTGCAGATTT
CCCGCCTCCGATTCCATTAG
AA sequence
>Lus10008625 pacid=23180094 polypeptide=Lus10008625 locus=Lus10008625.g ID=Lus10008625.BGIv1.0 annot-version=v1.0
MESINFAKGYGRVSTSTHLQPQDQPPHRPTKSIRKPLTAVASAVIILLIVLLAVHNHNSSNESLKKPEQHLPPSASVADSIRFVCNVTRYPNPCFTAISS
AMDSSSASDPEAILKVSIRVSLTRISDLASLFRNSSSSKSPAVDDCVDQLDEAKSNLKQSIAAMEEKALTEEKIADLKTWISAAMTDEETCRDGMEEMGA
TVAEGMKAEMEDCTEMMSNSLAILANLPSLLQISRLRFH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G47670 Plant invertase/pectin methyle... Lus10008625 0 1
AT1G78310 VQ motif-containing protein (.... Lus10010348 2.8 0.9035
AT1G34780 ATAPRL4 APR-like 4 (.1.2) Lus10010354 4.2 0.8701
AT3G02430 Protein of unknown function (D... Lus10012734 7.1 0.8992
AT1G18390 Protein kinase superfamily pro... Lus10022432 7.4 0.8822
AT1G71840 transducin family protein / WD... Lus10031629 9.4 0.8972
AT1G27730 C2H2ZnF ZAT10, STZ salt tolerance zinc finger (.1... Lus10014631 9.5 0.8918
AT1G33350 Pentatricopeptide repeat (PPR)... Lus10027311 9.7 0.8474
AT2G23290 MYB ATMYB70 myb domain protein 70 (.1) Lus10021762 10.1 0.8332
AT5G25940 early nodulin-related (.1) Lus10002236 19.2 0.8825
AT4G25030 unknown protein Lus10036513 20.2 0.8933

Lus10008625 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.