Lus10008640 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G53020 198 / 1e-65 RPL24B, STV1 SHORT VALVE1, Ribosomal protein L24e family protein (.1)
AT2G36620 197 / 1e-65 RPL24A ribosomal protein L24 (.1)
AT2G44860 74 / 3e-17 Ribosomal protein L24e family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035584 212 / 3e-71 AT2G36620 241 / 5e-83 ribosomal protein L24 (.1)
Lus10024560 199 / 6e-66 AT2G36620 238 / 2e-81 ribosomal protein L24 (.1)
Lus10032198 198 / 8e-66 AT2G36620 240 / 1e-82 ribosomal protein L24 (.1)
Lus10006314 192 / 2e-62 AT2G36620 233 / 2e-78 ribosomal protein L24 (.1)
Lus10029583 192 / 3e-62 AT2G36620 232 / 4e-78 ribosomal protein L24 (.1)
Lus10014637 81 / 3e-20 AT2G36620 100 / 6e-28 ribosomal protein L24 (.1)
Lus10020552 80 / 3e-19 AT2G44860 240 / 2e-82 Ribosomal protein L24e family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G139400 201 / 6e-67 AT3G53020 227 / 3e-77 SHORT VALVE1, Ribosomal protein L24e family protein (.1)
Potri.012G139500 201 / 6e-67 AT3G53020 227 / 3e-77 SHORT VALVE1, Ribosomal protein L24e family protein (.1)
Potri.015G141900 198 / 8e-66 AT3G53020 196 / 3e-65 SHORT VALVE1, Ribosomal protein L24e family protein (.1)
Potri.004G085300 197 / 2e-65 AT3G53020 199 / 2e-66 SHORT VALVE1, Ribosomal protein L24e family protein (.1)
Potri.003G123101 182 / 1e-59 AT3G53020 218 / 8e-74 SHORT VALVE1, Ribosomal protein L24e family protein (.1)
Potri.009G148500 76 / 9e-18 AT2G44860 248 / 1e-85 Ribosomal protein L24e family protein (.1.2)
Potri.004G187800 76 / 1e-17 AT2G44860 249 / 8e-86 Ribosomal protein L24e family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0175 TRASH PF01246 Ribosomal_L24e Ribosomal protein L24e
Representative CDS sequence
>Lus10008640 pacid=23180079 polypeptide=Lus10008640 locus=Lus10008640.g ID=Lus10008640.BGIv1.0 annot-version=v1.0
ATGGTGCTCAAGACGGAGCTCTGCAGGTTCAGTGGGCAGAAGATCTACCCAGGGAGAGGGATTAGATTCATTCGTTCTGACTCTCAGGTGTTCCTCTTTG
CCAACTCAAAGTGCAAGAGGTATTTCCACAACAGGTTGAAGCCATCCAAGCTAACATGGACGGCTGTCTTCAGGAAGCAACATAAGAAGGATATTGCTCA
AGAGGCAGTCAAGAAGAGGCGCAGGGCCACCAAGAAGCCTTACTCCAGGTCCATTGTTGGTGCAACCTTGGAGGTTATCCAGAAGAAGAGAACCGAGAAA
CCCGAAGTTCGTGATGCTGCTAGGGAAGCTGCGATCAGAGAAATCAAGGAAAGAATCAAGAAGACTAAAGACGAGAAGAAGGCCAAGAAAGTAGAAGTGA
GCAAGTCCCAGAAGTCTCAACCGAAAGGTGGTGCTGGAAGGGCTGCCCCGGCCAAGGGTCCTAAGCTTGGTGGTGGCGGTGGAAAGCGCTGA
AA sequence
>Lus10008640 pacid=23180079 polypeptide=Lus10008640 locus=Lus10008640.g ID=Lus10008640.BGIv1.0 annot-version=v1.0
MVLKTELCRFSGQKIYPGRGIRFIRSDSQVFLFANSKCKRYFHNRLKPSKLTWTAVFRKQHKKDIAQEAVKKRRRATKKPYSRSIVGATLEVIQKKRTEK
PEVRDAAREAAIREIKERIKKTKDEKKAKKVEVSKSQKSQPKGGAGRAAPAKGPKLGGGGGKR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G36620 RPL24A ribosomal protein L24 (.1) Lus10008640 0 1
AT3G25520 PGY3, ATL5, OLI... RIBOSOMAL PROTEIN L5 A, PIGGYB... Lus10019544 1.7 0.9131
AT4G25740 RNA binding Plectin/S10 domain... Lus10039282 2.8 0.8798
AT3G62870 Ribosomal protein L7Ae/L30e/S1... Lus10009322 4.5 0.8556
AT1G09690 Translation protein SH3-like f... Lus10030882 6.2 0.8723
AT3G25520 PGY3, ATL5, OLI... RIBOSOMAL PROTEIN L5 A, PIGGYB... Lus10043388 8.7 0.8659
AT3G45030 Ribosomal protein S10p/S20e fa... Lus10031706 9.5 0.8516
AT5G02960 Ribosomal protein S12/S23 fami... Lus10026479 10.6 0.8506
AT2G34480 Ribosomal protein L18ae/LX fam... Lus10019881 10.6 0.8485
AT4G02610 Aldolase-type TIM barrel famil... Lus10018760 14.5 0.7373
AT4G15000 Ribosomal L27e protein family ... Lus10010461 14.8 0.8361

Lus10008640 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.